Search by BoMiProt ID - Bomi9148


Primary Information

BoMiProt ID Bomi9148
Protein Name Short-chain specific acyl-CoA dehydrogenase, mitochondrial/Butyryl-CoA dehydrogenase
Organism Bos taurus
Uniprot IdQ3ZBF6
Milk FractionWhey
Ref Sequence Id NP_001029573.1
Aminoacid Length 412
Molecular Weight 44552
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBF6.fasta
Gene Name ACADS
Gene Id 511222
Protein Existence Status reviewed

Secondary Information

Protein Function catalyze the first step of mitochondrial fatty acid beta-oxidation.production of energy from fats. introduce a trans-otp-double-bond into saturated acyl-CoA substrates during beta-oxidation
Biochemical Properties a tetramer with a native Mr of approx. 162 000 and a subunit Mr of 41 000
Significance in milk regulate the metabolism of milk fat in dairy cattle.
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBF6|ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1 MAATLLARACGLVRGAPWPWGWRRLHT*27VYQSVELPETHQMLRQTCRDFAEKELFPIAAQV DKEHRFPAAQVKKMGELGLMAMNVPEELSGAGLDYLAYSIAMEEISRGCASTGVIMSVNN SLYLGPILKFGTKEQKQQWVAPFTSGDKIGCFALSEPGNGSDAGAAATTARADGDSWVLS GTKAWITNAWEASAVVVFASTDRSLHNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTAN LIFEDRRIPKDSLLGEPGLGFKIAMQTLDTGRIGIASQALGIAQAALDCAVTYAENRSAF GAPLTKLQAIQFKLADMALALESARLLTWRAAMLKDNKKPFTKEAAMAKLAASEAATAIT HQAMQILGGMGYVKEMPAERHYRDARITEIYEGTSEIQRLVVAGHLLKSYRS
Predicted Disorder Regions 1 disordered segment; (1-9)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Shaw L, Engel PC. The purification and properties of ox liver short-chain acyl-CoA dehydrogenase. Biochem J. 1984 Mar 1;218(2):511-20. doi: 10.1042/bj2180511. PMID: 6712627; PMCID: PMC1153367.