Search by BoMiProt ID - Bomi9135


Primary Information

BoMiProt ID Bomi9135
Protein Name Sharpin/Shank-associated RH domain-interacting protein
Organism Bos taurus
Uniprot IdE1BDF2
Milk Fractionwhey
Ref Sequence Id NP_001103236.1
Aminoacid Length 409
Molecular Weight 43394
Fasta Sequence https://www.uniprot.org/uniprot/E1BDF2.fasta
Gene Name SHARPIN
Gene Id 512499
Protein Existence Status Reviewed

Secondary Information

Protein Function It is a component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation
Biochemical Properties Associates with the TNF-R1 signaling complex (TNF-RSC) in a stimulation-dependent manner
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BDF2|SHRPN_BOVIN Sharpin OS=Bos taurus OX=9913 GN=SHARPIN PE=3 SV=1 MAPPAGGTAAGSDPGSAAVLLAVHVAVRPLGAGLDVAAQPRRLQLSADPERPGRFRLEML GAGPGAVILEWPLESVSYTVRGPCQHELQPPPGGPGTLSLHFANPQEAQRWAALVRDATV EGQNGSDSLPPALGPETRPVSPPSPLEVPTPKAPKPKVDLPWS*163PGDLMEKEELAGRLTRA VEGGDEKGAAQAAAILAQRHVALRVQLQEAYFPPGPIRLQVTVEDAASSAHVSLQVHPHC TIRALQEQVFSEFGFPPAVQRWVIGRCLCVPEHSLAFYGVQRDGDPAFLYLLSAPREAPG RS*302PQRPQKVDGELGRLFPQSLGLPPTPQPTSSSLPSPLQPGWPCPSCTFINAPSRPGCEM CSTQRPCAWDPLPTASIQQLPKVTRREDGPSLPGPRSLDPLLNLSGNLC
Predicted Disorder Regions 4-14, 38-40, 87-132, 142-182, 298-306, 321-339, 371-398
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs Serine 165 is the major phospho-acceptor site within SHARPIN.SHARPIN phosphorylation contributes to the optimal activation of NF-kB.
Bibliography 1.Thys A, Trillet K, Rosińska S, Gayraud A, Douanne T, Danger Y, Renaud CCN, Antigny L, Lavigne R, Pineau C, Com E, Vérité F, Gavard J, Bidère N. Serine 165 phosphorylation of SHARPIN regulates the activation of NF-κB. iScience. 2020 Dec 13;24(1):101939. doi: 10.1016/j.isci.2020.101939. PMID: 33392484; PMCID: PMC7773595. 2.Wang, Z., Potter, C. S., Sundberg, J. P., & Hogenesch, H. (2012). SHARPIN is a key regulator of immune and inflammatory responses. Journal of cellular and molecular medicine, 16(10), 2271–2279. https://doi.org/10.1111/j.1582-4934.2012.01574.x