Search by BoMiProt ID - Bomi9079


Primary Information

BoMiProt ID Bomi9079
Protein Name Serpin H1/Collagen-binding protein/Colligin
Organism Bos taurus
Uniprot IdQ2KJH6
Milk Fractionwhey
Ref Sequence Id NP_001039528.1
Aminoacid Length 418
Molecular Weight 46507
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJH6.fasta
Gene Name SERPINH1
Gene Id 510850
Protein Existence Status Reviewed

Secondary Information

Protein Function molecular maturation of collagen.it recognizes collagenous (Gly-Xaa-Arg) repeats on triple-helical procollagen and can prevent local unfolding and/or aggregate formation of procollagen.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJH6|SERPH_BOVIN Serpin H1 OS=Bos taurus OX=9913 GN=SERPINH1 PE=2 SV=1 MRALLLISTICLLARALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAK DQAVENILLSPVVVASSLGLVSLGGKAATASQAKAVLSAEQLRDDEVHAGLGELLRSLSN*120 STARN*125VTWKLGSRLYGPSSVS*141FAEDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQT TDGKLPEVTKDVERTDGALLVNAMFFKPHWDERFHHKMVDNRGFMVTRSYTVGVTMMHRT GLYNYYDDEKEKLQMVEMPLAHKLSSLIIIMPHHVEPLERLEKLLTKEQLKVWMGKMQKK AVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWD TDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography Ito S, Nagata K. Biology of Hsp47 (Serpin H1), a collagen-specific molecular chaperone. Semin Cell Dev Biol. 2017 Feb;62:142-151. doi: 10.1016/j.semcdb.2016.11.005. Epub 2016 Nov 9. PMID: 27838364.