Search by BoMiProt ID - Bomi9069


Primary Information

BoMiProt ID Bomi9069
Protein Name Serine-threonine kinase receptor-associated protein
Organism Bos taurus
Uniprot IdQ5E959
Milk FractionExosomes
Ref Sequence Id NP_001015567.1
Aminoacid Length 350
Molecular Weight 38485
Fasta Sequence https://www.uniprot.org/uniprot/Q5E959.fasta
Gene Name STRAP
Gene Id 510201
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells vertebral column 
Protein Function The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A forming an intermediate. Binding of snRNA inside 5Sm triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP. STRAP plays a role in the cellular distribution of the SMN complex.
PTMs Phosphorylation at Ser/Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E959|STRAP_BOVIN Serine-threonine kinase receptor-associated protein OS=Bos taurus OX=9913 GN=STRAP PE=2 SV=1 MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKG AVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQ DKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSL NFNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFVVA GGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKTY GLWKCVLPEEDS*312GELAKPKINFPETAEEELEEIAS*335ENS*338DSIY*342SSTPEVKA
Predicted Disorder Regions 311-350
DisProt Annotation
TM Helix Prediction No TM helices