Search by BoMiProt ID - Bomi9051


Primary Information

BoMiProt ID Bomi9051
Protein Name Serine/threonine-protein kinase PRP4 homolog/PRP4 pre-mRNA-processing factor 4 homolog
Organism Bos taurus
Uniprot IdQ08DZ2
Milk FractionWhey
Ref Sequence Id NP_001069025.1
Aminoacid Length 1008
Molecular Weight 116646
Fasta Sequence https://www.uniprot.org/uniprot/Q08DZ2.fasta
Gene Name PRPF4B
Gene Id 512236
Protein Existence Status reviewed

Secondary Information

Protein Function PRP4 kinase domain is responsible for promoting drug resistance to curcumin by inducing EMT.This protein kinase as a novel protein kinase required for regulation of proper chromosome segregation during meiosis
PTMs N6-Acetylation at Lys, Isopeptide bond formation, Phosphorylation at Ser/Thr, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DZ2|PRP4B_BOVIN Serine/threonine-protein kinase PRP4 homolog OS=Bos taurus OX=9913 GN=PRPF4B PE=2 SV=1 MAAAEAPS*8LREQPEMEDANS*20EKS*23VNEENGEVS*32EDQSQNKHSRHKKKKHKHRSKHKKHKHS SEEDKDRKHKHKHKHKKHKRKEVADAS*87DKEGMS*93PAKRTKLDDLALLEDLEKQRALIKAEL DNELMEGKVQS*131GMGLILQGY*140ES*142GS*144EEEGEIHEKARNGNRSSTRSSS*166TKGKLELVDNKNSTKKRSKSRSKERTRHRSDKKKSKGGVEIVKEKATRSKSKERKKSKSPSKRSKSQDEARKS*239K S*241PTLRRRSQEKVGKARS*257PVDDKAKVEDKSKAKDRKKS*277PVINES*283RSRDRGKKS*292RS*294PVDLRGKSKDRRSRSKERKSKRPEADKEKKPVKS*328PSKDASSGKENRSPSRRPGRSPKRRS*354LS*356PKQRDKSRRS*366RS*368PLVNDRRSKQSKSPSRT*385LS*387PGRRAKSRSLERKRREPERRRLSSPRTRPRDDILSRRERS*427KDAS*431PISRWS*437PARRRASRSPVRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSRLRRRSRSRGGRRRRSRSKVKEDKFKGSLSEGMKVEQES*519S*520S*521DDNLEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLADDSNLSVPS*566EPSS*570PQSSTRS*577RS*579PS*581PDDILERVAADVKEYERENVDTFEASVKAKHNLMAVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFK ENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKII RNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLK KYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSAS HVADNDITPY*850LVS*853RFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLK LAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADL IGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQEKI
Predicted Disorder Regions 8-97, 133-567
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments PRP4 overexpression altered the morphology, rearranged the actin cytoskeleton, triggered epithelial-mesenchymal transition (EMT), and decreased the invasiveness of HCT116 cells. 
Bibliography 1.Ahmed MB, Islam SU, Sonn JK, Lee YS. PRP4 Kinase Domain Loss Nullifies Drug Resistance and Epithelial-Mesenchymal Transition in Human Colorectal Carcinoma Cells. Mol Cells. 2020 Jul 31;43(7):662-670. doi: 10.14348/molcells.2020.2263. PMID: 32576716; PMCID: PMC7398799. 2.Islam SU, Ahmed MB, Lee SJ, Shehzad A, Sonn JK, Kwon OS, Lee YS. PRP4 kinase induces actin rearrangement and epithelial-mesenchymal transition through modulation of the actin-binding protein cofilin. Exp Cell Res. 2018 Aug 1;369(1):158-165. doi: 10.1016/j.yexcr.2018.05.018. Epub 2018 May 19. PMID: 29787735.