Search by BoMiProt ID - Bomi9050


Primary Information

BoMiProt ID Bomi9050
Protein Name Serine/threonine-protein kinase PLK4/Polo-like kinase 4/Serine/threonine-protein kinase Sak
Organism Bos taurus
Uniprot IdA2VDZ4
Milk FractionWhey
Ref Sequence Id NP_001076896.1
Aminoacid Length 893
Molecular Weight 100707
Fasta Sequence https://www.uniprot.org/uniprot/A2VDZ4.fasta
Gene Name PLK4/SAK
Gene Id 514405
Protein Existence Status reviewed

Secondary Information

Protein Function role in centrosome duplication.When PLK4 is chemically inhibited, cell division proceeds without centrosome duplication, generating centrosome-less cells that exhibit delayed, acentrosomal spindle assembly.
PTMs Ubl conjugation,Acetylation on Lys, Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus OX=9913 GN=PLK4 PE=2 SV=1 MATCIGEKIEDFRVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE VKIHCQLKHPSILELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRRKPFSENEARHFMHQI ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLAAQLKMPHEKHYTLCGTPNYISP EIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPTFLSREAKD LIHQLLRRNPADRLSLSSVLDHPFMSRNSSKKSKDLGTVEDSIDSGHATISTAITASSST SISGSLFDRRRLLIEQPLPNKMTIFPKNKNPSDFSSSGDGISFYTSWGNQEQETSNSGRG RVIQEAEERPHSRYLRRAHSSDRSETSHGQSRVKTYTMERCYS*403AEMLSKSKRSGVEENER YSPTNNDANIFHFFKEKTSNSSGSFEGPDNNQALSNHLCPGKTPFPFPEQTPQTEMVQQW FGNLQINDPSCEQSKTRGVEPPLVYQKRTLRSITSPLTAYRLKPIRQKTKKAVVSILDSE EVCVELLKDYASQEYVKEVLQISSDGSMITIYYPNDGRGFLLADRPPS*588PTDNISRYSFDN LPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCVLMENSPGADFEVWFYDGAKIHKTE DLIQVIEKTGRSYTLKGESEVNSLKEEVKMYMNHANEGHRICLALESIISEEEKKSGSAP FFPIIVGRRPSSTSSPKALTPPPPVDPNYPMRETPSLNRMIINSAASPKQAPVLNPPVVT NEGLGLMGAASETNSSPRSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQL VVQAGVSSISYTSPDGQTTRYGENEKLPEYIKQKLQCLSSILLMFSNPTPSFH
Predicted Disorder Regions 330-337, 386-388, 416-426, 459-482, 734-802
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Ubl conjugation by TRIM37,a TRIpartite Motif ubiquitin ligase,which functions as a rheostat that controls cell division.Spata2 recruits the deubiquitinase CYLD to the centrosome for deubiquitination of polo-like kinase 4 (PLK4),which supresses inflammasome activation at the centrosome.
Bibliography 1.Yang XD, Li W, Zhang S, Wu D, Jiang X, Tan R, Niu X, Wang Q, Wu X, Liu Z, Chen LF, Qin J, Su B. PLK4 deubiquitination by Spata2-CYLD suppresses NEK7-mediated NLRP3 inflammasome activation at the centrosome. EMBO J. 2020 Jan 15;39(2):e102201. doi: 10.15252/embj.2019102201. Epub 2019 Nov 25. PMID: 31762063; PMCID: PMC6960439. 2.Meitinger F, Ohta M, Lee KY, Watanabe S, Davis RL, Anzola JV, Kabeche R, Jenkins DA, Shiau AK, Desai A, Oegema K. TRIM37 controls cancer-specific vulnerability to PLK4 inhibition. Nature. 2020 Sep;585(7825):440-446. doi: 10.1038/s41586-020-2710-1. Epub 2020 Sep 9. PMID: 32908304; PMCID: PMC7501188.