Primary Information |
---|
BoMiProt ID | Bomi9037 |
---|
Protein Name | Serine/arginine-rich splicing factor 1/Splicing factor, arginine/serine-rich 1 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q0VCY7 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001069862.1 |
---|
Aminoacid Length | 248 |
---|
Molecular Weight | 27745 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q0VCY7.fasta |
---|
Gene Name | SRSF1 |
---|
Gene Id | 615796 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | abdominal lymph node |
---|
Protein Function | Serine/arginine-rich splicing factor 1 (SRSF1) has been linked to various human cancers including pediatric acute lymphoblastic leukemia (ALL).Serine/arginine‐rich splicing factor 1 is also connected to genomic instability, cell‐cycle arrest, and apoptosis. |
---|
PTMs | Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VCY7|SRSF1_BOVIN Serine/arginine-rich splicing factor 1 OS=Bos taurus OX=9913 GN=SRSF1 PE=2 SV=1
MS*2GGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGS*133WQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRS*199PS*201Y*202GRS*205RS*207RS*209RSRSRSRSRSNSRSRSYSPRRS*231RGS*234PRYS*238PRHSRSRSRT
|
---|
Predicted Disorder Regions | 1-11, 89-103, 190-248 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Methylation by PRMT1 promotes localization to nuclear speckles.Phosphorylated by SRPK1 at multiple serines in its RS domain via a directional (C-terminal to N-terminal) and a dual-track mechanism incorporating both processive phosphorylation and distributive phosphorylation steps. |
---|
Bibliography | 1.Xu L, Zhang H, Mei M, Du C, Huang X, Li J, Wang Y, Bao S, Zheng H. Phosphorylation of serine/arginine-rich splicing factor 1 at tyrosine 19 promotes cell proliferation in pediatric acute lymphoblastic leukemia. Cancer Sci. 2018 Dec;109(12):3805-3815. doi: 10.1111/cas.13834. Epub 2018 Nov 14. PMID: 30320932; PMCID: PMC6272096. 2.Das S, Krainer AR. Emerging functions of SRSF1, splicing factor and oncoprotein, in RNA metabolism and cancer. Mol Cancer Res. 2014;12:1195‐1204. |