Search by BoMiProt ID - Bomi9037


Primary Information

BoMiProt ID Bomi9037
Protein Name Serine/arginine-rich splicing factor 1/Splicing factor, arginine/serine-rich 1
Organism Bos taurus
Uniprot IdQ0VCY7
Milk FractionWhey
Ref Sequence Id NP_001069862.1
Aminoacid Length 248
Molecular Weight 27745
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCY7.fasta
Gene Name SRSF1
Gene Id 615796
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells abdominal lymph node
Protein Function Serine/arginine-rich splicing factor 1 (SRSF1) has been linked to various human cancers including pediatric acute lymphoblastic leukemia (ALL).Serine/arginine‐rich splicing factor 1 is also connected to genomic instability, cell‐cycle arrest, and apoptosis.
PTMs Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCY7|SRSF1_BOVIN Serine/arginine-rich splicing factor 1 OS=Bos taurus OX=9913 GN=SRSF1 PE=2 SV=1 MS*2GGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE NRVVVSGLPPSGS*133WQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF RSHEGETAYIRVKVDGPRS*199PS*201Y*202GRS*205RS*207RS*209RSRSRSRSRSNSRSRSYSPRRS*231RGS*234PRYS*238PRHSRSRSRT
Predicted Disorder Regions 1-11, 89-103, 190-248
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Methylation by PRMT1 promotes localization to nuclear speckles.Phosphorylated by SRPK1 at multiple serines in its RS domain via a directional (C-terminal to N-terminal) and a dual-track mechanism incorporating both processive phosphorylation and distributive phosphorylation steps.
Bibliography 1.Xu L, Zhang H, Mei M, Du C, Huang X, Li J, Wang Y, Bao S, Zheng H. Phosphorylation of serine/arginine-rich splicing factor 1 at tyrosine 19 promotes cell proliferation in pediatric acute lymphoblastic leukemia. Cancer Sci. 2018 Dec;109(12):3805-3815. doi: 10.1111/cas.13834. Epub 2018 Nov 14. PMID: 30320932; PMCID: PMC6272096. 2.Das S, Krainer AR. Emerging functions of SRSF1, splicing factor and oncoprotein, in RNA metabolism and cancer. Mol Cancer Res. 2014;12:1195‐1204.