Search by BoMiProt ID - Bomi9033


Primary Information

BoMiProt ID Bomi9033
Protein Name Serine protease 23
Organism Bos taurus
Uniprot IdQ1LZE9
Milk FractionWhey
Ref Sequence Id NP_001073775.1
Aminoacid Length 375
Molecular Weight 42446
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZE9.fasta
Gene Name PRSS23
Gene Id 538575
Protein Existence Status reviewed

Secondary Information

Protein Function Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
PTMs Disulfide bond, Glycoprotein
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZE9|PRS23_BOVIN Serine protease 23 OS=Bos taurus OX=9913 GN=PRSS23 PE=2 SV=1 MAGTPGHPIFLLLLLRAIGQVSPYSTHWKPTWPAYRLPVVLPQSTFNLAKPDFGAEAKLE VSSSCGPQCHKGTPLPTYEEAKQYLSYETLYAN*93GSRTETQVGIYVLRSGEEQSSGKSRRK RQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGT QKLRVGFLKPKFKDGRGAN*199DSHSALPEKMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYA LLELKKPHKRKFMKIGVSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVQDETYDLLYQQ CDAQPGASGSGVYVRMWKRQQQKWERKIIGIFSGHQWVDVNGSPQDFNVAVRITPLKYAQ ICYWIKGNYVDCREG
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices