Search by BoMiProt ID - Bomi9017


Primary Information

BoMiProt ID Bomi9017
Protein Name Seminal plasma protein BSP-30 kDa
Organism Bos taurus
Uniprot IdP81019
Milk FractionWhey
Ref Sequence Id NP_777267.1
Aminoacid Length 183
Molecular Weight 21269
Fasta Sequence https://www.uniprot.org/uniprot/P81019.fasta
Gene Id 317699
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  mammary gland fat
Protein Function BSP-30K is a major acidic glycoprotein of bovine seminal plasma. It displays heparin-, gelatin-, and phospholipid-binding activities. BSP-30K binds to spermatozoa upon ejaculation and is thought to play a role in sperm capacitation. 
Biochemical Properties BSP-30K has a unique 48-residue N-terminal extension which includes three 7–8- amino acid repeats and the six O-glycosylated threonine residues. The polypeptide stretch 49–71 is homologous to type ‘A’ domains found in heparin-binding proteins from other mammalian species. The C-terminal portion of BSP-30K is organized in a tandem of 40–44-residue domains each sharing the consensus pattern of the gelatin-binding fibronectin type II module.
PTMs Disulfide bond formation,O-Linked Glycosylation at Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P81019|SFP4_BOVIN Seminal plasma protein BSP-30 kDa OS=Bos taurus OX=9913 PE=1 SV=2 MAPLVGLFLIWAGASVFQQLHPVNGGDIPDPGSKPT*36PPGMADELPT*46ETYDLPPEIYT*57T*58T*59F LPRT*64IYPQEEMPYDDKPFPSLLSKANDLNAVFEGPACAFPFTYKGKKYYMCTRKNSVLLW CSLDTEYQGNWKFCTERDEPECVFPFIYRKKSYESCTRVHSFFWRRWCSLTSNYDRDKAW KYC
Predicted Disorder Regions 19-82
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Calvete JJ, Mann K, Sanz L, Raida M, Töpfer-Petersen E. The primary structure of BSP-30K, a major lipid-, gelatin-, and heparin-binding glycoprotein of bovine seminal plasma. FEBS Lett. 1996 Dec 9;399(1-2):147-52. doi: 10.1016/s0014-5793(96)01310-5. PMID: 8980140.