Search by BoMiProt ID - Bomi9016


Primary Information

BoMiProt ID Bomi9016
Protein Name Semaphorin-3C
Organism Bos taurus
Uniprot IdA7MB70
Milk FractionWhey
Ref Sequence Id NP_001094552.1
Aminoacid Length 751
Molecular Weight 85237
Fasta Sequence https://www.uniprot.org/uniprot/A7MB70.fasta
Gene Name SEMA3C
Gene Id 512660
Protein Existence Status reviewed

Secondary Information

Protein Function Semaphorin 3 C drives epithelial-to-mesenchymal transition.Binds to plexin family members and plays an important role in the regulation of developmental processe. Required for normal cardiovascular development during embryogenesis. Functions as attractant for growing axons, and thereby plays an important role in axon growth and axon guidance.
Significance in milk role in embryogenesis and neuronal development
PTMs N linked Glycosylation Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7MB70|SEM3C_BOVIN Semaphorin-3C OS=Bos taurus OX=9913 GN=SEMA3C PE=2 SV=1 MAFQAVCILVGVFVCSTYVKGSPQPQARVYLTFDELRETKTSEYFSLSQYPLDYRILLMD EDQDRMYVGSKDHILSLNINN*81ISQEPLSVFWPASAIKVEECKMAGKDPTHGCGNFVRVIQ AFN*123RTHLYVCGSGAFSPVCAYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV YFFFKEKLTDNSRSTKQIHSMIARICPN*268DTGGLRSLVNKWTTFLKARLVCSVTDEDGPET HFDELEDVFLLEMDNPRTTLVYGIFTTSSSVFKGSAVCVYHFSDIQTVFNGPFAHKEGPN HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPVHRRPLI VRIGTDYKYTKIAVDRVNAADGTYNVLFLGTDRGTVQKVVVLPTN*465SSARSELILEELEVF KNHAPITTMKISSKKQQLYVSSNEGLAQVSLHRCHIYGSACADCCLARDPYCAWDGHSCS RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKN*585N*586TTFLECAPKSPQAS IKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQDSDQGLYHCIATENSFKQTIAKINFK VLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGE ESQKMRGDYGKLKALINSRKSRNRRNQLPES
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Hui DHF, Tam KJ, Jiao IZF, Ong CJ. Semaphorin 3C as a Therapeutic Target in Prostate and Other Cancers. Int J Mol Sci. 2019 Feb 12;20(3):774. doi: 10.3390/ijms20030774. PMID: 30759745; PMCID: PMC6386986.