Search by BoMiProt ID - Bomi9003


Primary Information

BoMiProt ID Bomi9003
Protein Name Selenoprotein P
Organism Bos taurus
Uniprot IdP49907
Milk FractionCasein,MFGM
Ref Sequence Id NP_776884.2
Aminoacid Length 402
Molecular Weight 45488
Fasta Sequence https://www.uniprot.org/uniprot/P49907.fasta
Gene Name SELENOP
Gene Id 282066
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells found in plasma
Protein Function play an important role in developing and/or modulating the morphology of neurons and/or glial cells.
Biochemical Properties Selenoprotein P (SeP) is an extracellular, monomeric glycoprotein containing up to 10 selenocysteine residues in the polypeptide chain
Significance in milk Major selenium transporter protein in milk principally produced in liver and lung.High intake of Se might be related to high levels of plasma selenoprotein P, yet low GPx activity, observed in Type 2 diabetes.
PTMs Phosphorylation,Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P49907|SEPP1_BOVIN Selenoprotein P OS=Bos taurus OX=9913 GN=SELENOP PE=2 SV=2 MWRGLGLALALCLLLTGGTESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASUY LCILQASRLEDLRVKLEKEGYSN*83ISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQ PDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGN*174CSLKAL EDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLS ESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGS*284ESLQPSLPQKKLURKR CINQLLUQFPKDSESALSSCCCHCRHLVFEKTGSAITUQCTEKLPSLCSUQGLLAEENVI ESUQURLPPAAUQAAGQQLNPTEASTKUSUKNKAKMUKUPSN
Predicted Disorder Regions (196-291), (366-402)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs
Additional Comments Some diseases may be associated with high levels of Se markers (e.g., GPx and selenoprotein P). Findings indicate that high Se exposure may be associated with Type 2 diabetes.
Bibliography 1.Claudia Cobo-Angel, Jeffrey Wichtel, Alejandro Ceballos-Márquez, Selenium in milk and human health, Animal Frontiers, Volume 4, Issue 2, April 2014, Pages 38–43, https://doi.org/10.2527/af.2012-0013 2.Saijoh K, Saito N, Lee MJ, Fujii M, Kobayashi T, Sumino K. Molecular cloning of cDNA encoding a bovine selenoprotein P-like protein containing 12 selenocysteines and a (His-Pro) rich domain insertion, and its regional expression. Brain Res Mol Brain Res. 1995 Jun;30(2):301-11. doi: 10.1016/0169-328x(94)00007-2. PMID: 7637580.