Search by BoMiProt ID - Bomi8997


Primary Information

BoMiProt ID Bomi8997
Protein Name Secretory carrier-associated membrane protein 4
Organism Bos taurus
Uniprot IdQ58DF6
Milk FractionExosomes
Ref Sequence Id NP_001019737.1
Aminoacid Length 230
Molecular Weight 25595
Fasta Sequence https://www.uniprot.org/uniprot/Q58DF6.fasta
Gene Name SCAMP4
Gene Id 538819
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells pons 
Protein Function SCAMP4 belongs to the Secretory carrier membrane proteins (SCAMPs) family which were initially found in components of regulated secretory carriers in secretory and endocytic.SCAMP4 is a novel cells surface protein to promote the secretion of SASP factor and enhance the SASP phenotype by accumulating on the surface of senescent cells.
PTMs Phosphorylation at Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58DF6|SCAM4_BOVIN Secretory carrier-associated membrane protein 4 OS=Bos taurus OX=9913 GN=SCAMP4 PE=2 SV=1 MSGKENNFPPLPKFIPLKPCFYQNFSDEIPIEHQVLVKRIYRLWLFYCATLGVNLVACLA WWIAGGSGANFGLALLWLLLFSPCGYVCWFRPAYKAFRSDSSFNFMAFFFIFGAQFILTI IQAVGFSGWGACGWLAAIGFFQTSVGAAVVMLLPAIMFSMSAAMMAVMIMKVHSIYRGTG GSFQKAQTEWSTGT*194WRNPPSREAQFNNFSGNSLPEYPTVPSYPASGGQWP
Predicted Disorder Regions 1-7, 185-230
DisProt Annotation
TM Helix Prediction 1TMH; (43-65),(69-91),(104-126),(145-167)
Bibliography 1.Ge X, Wang Z, Jiang R, Ren S, Wang W, Wu B, Zhang Y, Liu Q. SCAMP4 is a novel prognostic marker and correlated with the tumor progression and immune infiltration in glioma. Int J Biochem Cell Biol. 2021 Oct;139:106054. doi: 10.1016/j.biocel.2021.106054. Epub 2021 Aug 12. PMID: 34390854.