Search by BoMiProt ID - Bomi8994


Primary Information

BoMiProt ID Bomi8994
Protein Name Secretogranin-1/Chromogranin-B/Secretogranin I
Organism Bos taurus
Uniprot IdP23389
Milk FractionWhey
Ref Sequence Id NP_851349.1
Aminoacid Length 646
Molecular Weight 73340
Fasta Sequence https://www.uniprot.org/uniprot/P23389.fasta
Gene Name CHGB
Gene Id 281071
Protein Existence Status reviewed

Secondary Information

Protein Function CgB is necessary for efficient trafficking of secretory proteins into the budding granule, which impacts the availability of insulin-containing secretory granules for exocytic release.
Biochemical Properties CgB, also known as secretogranin I, belongs to the same granin family as CgA. CgB is a secretory protein consisting of 657 amino acids, localized in the healthy pancreas and within secretory granules of neuroendocrine cells, and it regulates hormone production via intracellular processing
PTMs Disulfide bond formation,O-Linked Glycosylation at Thr, Phosphorylation at Ser-168,351,354,584,593 and 598,Sulfation at Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P23389|SCG1_BOVIN Secretogranin-1 OS=Bos taurus OX=9913 GN=CHGB PE=1 SV=2 MQPAALLGLLGATVVAAVSSMPVDIRNHNEEVVTHCIIEVLSNALLKSSAPPITPECRQV LKKNGKELKNEEKS*74ENENT*79RFEVRLLRDPADT*92S*93EAPGLS*99S*100REDS*104GEGDAQVPT*113VADTESG GHS*123RERAGEPPGSQVAKEAKTRYSKS*146EGQNREEEMVKYQKRERGEVGS*168EERLSEGPGKAQ TAFLNQRNQT*190PAKKEELVSRYDTQS*205ARGLEKSHSRERSSQESGEETKSQENWPQELQRHP EGQEAPGESEEDASPEVDKRHSRPRHHHGRSRPDRS*276S*277QEGNPPLEEESHVGTGNS*295DEEKA RHPAHFRALEEGAEYGEEVRRHSAAQAPGDLQGARFGGRGRGEHQALRRPS*351EES*354LEQENK RHGLSPDLNMAQGY*374S*375EES*378EEERGPAPGPSYRARGGEAAAYSTLGQTDEKRFLGETHHRVQ ESQRDKARRRLPGELRNYLDYGEEKGEEAARGKWQPQGDPRDADENREEARLRGKQYAPH HITEKRLGELLNPFYDPSQWKS*502S*503RFERKDPMDDS*514FLEGEEENGLTLNEKNFFPEYNYDWW EKKPFEEDVNWGYEKRNPVPKLDLKRQYDRVAELDQLLHYRKKS*584AEFPDFYDS*593EEQMS*598PQ HTAENEEEKAGQGVLTEEEEKELENLAAMDLELQKIAEKFSGTRRG
Predicted Disorder Regions 13-21, 42-476, 592-646
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs  All PTM leads to a complex structure of this protein making it a marker of the neuroendocrine system.
Additional Comments Loss of CgB impairs glucose-stimulated insulin secretion, impedes proinsulin processing to yield increased proinsulin content, and alters the density of insulin-containing granules. 
Bibliography 1.Bearrows SC, Bauchle CJ, Becker M, Haldeman JM, Swaminathan S, Stephens SB. Chromogranin B regulates early-stage insulin granule trafficking from the Golgi in pancreatic islet β-cells. J Cell Sci. 2019 Jul 1;132(13):jcs231373. doi: 10.1242/jcs.231373. PMID: 31182646; PMCID: PMC6633396. 2.Miki M, Ito T, Hijioka M, Lee L, Yasunaga K, Ueda K, Fujiyama T, Tachibana Y, Kawabe K, Jensen RT, Ogawa Y. Utility of chromogranin B compared with chromogranin A as a biomarker in Japanese patients with pancreatic neuroendocrine tumors. Jpn J Clin Oncol. 2017 Jun 1;47(6):520-528. doi: 10.1093/jjco/hyx032. PMID: 28334992; PMCID: PMC6283109. 3.Gasnier C, Lugardon K, Ruh O, Strub JM, Aunis D, Metz-Boutigue MH. Characterization and location of post-translational modifications on chromogranin B from bovine adrenal medullary chromaffin granules. Proteomics. 2004 Jun;4(6):1789-801. doi: 10.1002/pmic.200300693. PMID: 15174145.