Search by BoMiProt ID - Bomi8957


Primary Information

BoMiProt ID Bomi8957
Protein Name Scavenger receptor cysteine-rich type 1 protein M130/CD_antigen: CD163
Organism Bos taurus
Uniprot IdP85521
Milk FractionWhey
Ref Sequence Id NP_001156885.1
Aminoacid Length 1129
Molecular Weight 121806
Fasta Sequence https://www.uniprot.org/uniprot/P85521.fasta
Gene Name CD163/M130
Gene Id 533844
Protein Existence Status reviewed

Secondary Information

Protein Function CD163 is a potential inflammation biomarker and a therapeutic target. 
Biochemical Properties CD163 is a 130-kDa membrane protein with a short cytoplasmic tail, a single transmembrane segment, and a large ectodomain consisting of nine scavenger receptor cysteine rich (SRCR) scavenger receptor class B domains.The SRCR domain is a common 100–110 amino acid domain for molecular interactions and with a determined structural fold of six or seven b-sheets cradling an a-helix. The SRCR class A and class B domains share a similar fold and differ only by the presence of an additional disulfide bond in the class B domains. Whereas SRCR class A domains largely are present as single domains in different mosaic domain proteins, including the scavenger receptor, AI and MARCO.
PTMs Disulfide bond formation,N-Linked Glycosylation at Asn, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P85521|C163A_BOVIN Scavenger receptor cysteine-rich type 1 protein M130 OS=Bos taurus OX=9913 GN=CD163 PE=1 SV=2 MVLHDNSGSAGFKRCSVHFGPFTLAVVSVLYACLITSALGGTDKELRLVAGQTKCSGRVE VKVQEEWGTVCNTGWDLAAVSVVCKQLGCPSVIKATGWTN*100SSAGTGRIWMDHVSCRGN*118ES ALWDCKHEGWGKHN*134CTHQQDVGVTCSDGSDLEMRLMNGGNRCSGRIEIKFQGQWGTVCDD NFNLDHASVVCKQLGCGSAVSFSGSANFGEGSGPIWFDDLVCHGN*225ESALWNCRHEGWGKH NCDHAEDAGVICLEGADLSLRLVDGVTKCSGRLEVRFQGEWGTVCDDGWDSDDAAVACQQ LGCPTAITAVGRVN*314ASEGTGHIWLDSVSCQGHESAVWQCRHHEWGKHYCNHNEDAGVTCS DGSDLELRLKGGGSRCAGTVEVEIQKLIGKVCDRSWGLKEADVVCKQLGCGSALRTSYQV YSKIQATNTWLFLNNCNGN*439ETSIWDCKNWQWGGLSCEHYHEAKVTCSAHREPRLVGGDIP CSGRVEVKHGDTWGTICDSDFSLESASVLCRELECGSVVSILGGAHFGEGNGQIWAEEFQ CEGN*544ESHLSLCPVAPRLDGTCSHSKDIGVVCSRYTEVRLVGGNTPCEGRVEVKILGTWGP LCNSHWDMEDAHVLCQQLKCGVAASIPGRAPFGKGSGQPWRHMFHCTGTEQHMGDCPVTA LGASLCPEGQVASVICSGN*679RSQTLYPCN*688SSSSDPESSVVLEENGVPCIGSGQLRLVNGGG RCAGRIEVYHEGSWGTICDDSWDLDDAHVVCRQLGCGVAIN*761ATGSAHFGEGSGPIWLDEV NCNGKEPRISQCRSHGWGRQNCRHKEDAGVICSEFMSLRLISDSSSETCAGRLEVFYNGA WGSVGKSDMSATTVGVVCRQLGCTDKGSIRPAPSDKVENRYMWVDNVRCPKGPETLWQCP SSPWKRRLASPSEETWITCADKIRLQEGTTN*931CSGRVEVWHGGSWGTVCDDSWDLNDAQVV CRQLGCGLALEAGKEAAFGQGTGPIWLNEVKCKGN*995ESSLWDCPARSWGHSDCGHKEDASV KCSEIAESKGSVKAAGHSSTVALGILGVILLAFLIATLLWIQRRRQRQRLAVSSRGENSV HEIQYREMNSCLKADDLDLYNSSGLWVLRGSIALGFRLVTAAEAERHST
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 2TMHs; (20-42),(1039-1061)
Significance of PTMs A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This proteolytic cleavage is performed by protein kinase C and tyrosine kinases and can be blocked by protease inhibitors.
Additional Comments A high CD163 expression in macrophages is a characteristic of tissues responding to inflammation.The expression of CD163 is strongly induced by anti-inflammatory mediators such as glucocorticoids and interleukin-10, while being inhibited by pro-inflammatory mediators such as interferon-gamma.
Bibliography 1Kowal K, Silver R, Sławińska E, Bielecki M, Chyczewski L, Kowal-Bielecka O. CD163 and its role in inflammation. Folia Histochem Cytobiol. 2011;49(3):365-74. doi: 10.5603/fhc.2011.0052. PMID: 22038213. 2.Etzerodt A, Moestrup SK. CD163 and inflammation: biological, diagnostic, and therapeutic aspects. Antioxid Redox Signal. 2013 Jun 10;18(17):2352-63. doi: 10.1089/ars.2012.4834. Epub 2012 Oct 19. PMID: 22900885; PMCID: PMC3638564.