Search by BoMiProt ID - Bomi8895


Primary Information

BoMiProt ID Bomi8895
Protein Name RNA-binding protein with serine-rich domain 1
Organism Bos taurus
Uniprot IdA6QR16
Milk FractionWhey
Ref Sequence Id NP_001095311.1
Aminoacid Length 305
Molecular Weight 34196
Fasta Sequence https://www.uniprot.org/uniprot/A6QR16.fasta
Gene Name RNPS1
Gene Id 504506
Protein Existence Status reviewed

Secondary Information

Protein Function  a component of pre-splicing and post-splicing multiprotein complexes, which activates constitutive and alternative splicing.participates in the formation of the spliceosome and activates the pre-mRNA splicing process.
PTMs ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QR16|RNPS1_BOVIN RNA-binding protein with serine-rich domain 1 OS=Bos taurus OX=9913 GN=RNPS1 PE=2 SV=1 MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESS*53EKDRGRD KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSS SGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRS*155PS*157PKPT*161KVHIGRLTRNVTKDHIMEI FSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLA PWPRPPPRRFSPPRRMLPPLPMWRRSPPRMRRRSRSPRRRSPARRRSRSPGRRRHRSRSS SNSSR
Predicted Disorder Regions 1-160, 238-253, 261-305
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs  RNPS1 is polyubiquitinated by both K48- and K63-linkages, USP4 exclusively deubiquitinates K63-linked polyubiquitin chains of RNPS1.
Bibliography Kwon SK, Kim EH, Baek KH. RNPS1 is modulated by ubiquitin-specific protease 4. FEBS Lett. 2017 Jan;591(2):369-381. doi: 10.1002/1873-3468.12531. Epub 2017 Jan 8. PMID: 27990632.