Search by BoMiProt ID - Bomi8893


Primary Information

BoMiProt ID Bomi8893
Protein Name RNA-binding protein 42/RNA-binding motif protein 42
Organism Bos taurus
Uniprot IdQ0P5L0
Milk FractionWhey
Ref Sequence Id NP_001069673.1
Aminoacid Length 448
Molecular Weight 47187
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5L0.fasta
Gene Name RBM42
Gene Id 540172
Protein Existence Status reviewed

Secondary Information

Protein Function role in the maintenance of cellular ATP level in the stress conditions possibly through protecting their target mRNAs.RBM42 also directly bound to the 3' untranslated region of p21 mRNA, one of the target mRNAs for hnRNP K.hnRNP K is also a RNA-binding protein
Biochemical Properties contains one RRM in its C-terminal region, as a binding partner of hnRNP K.RBM42 directly bound to 3′ UTR of p21 mRNA.
PTMs Acetylation on Ala, Methylation, Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5L0|RBM42_BOVIN RNA-binding protein 42 OS=Bos taurus OX=9913 GN=RBM42 PE=2 SV=1 MAGAGPAPGLPGAGGPVVPGPGAGIPGKSGEERLKEMEAEMALFEQEVLGAPVTGIPTAV PAVPTVPTVEAMQVPAAPVIRPIIATNTYQQVQQTLEARAAAAATVVPPMVGGPPFVGPV GFGPGDRSHLDS*132PEAREAMFLRRAAAGPRPMALRPPHQALVGPPLPGPPGPPMMLPPMAR APGPPLGSMAALRPPLEEPATPRELGLGLGLGLKEKEEAVVAAAAGLEEASAVVAVGAGG APAGPAVIGPSLPLALAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPP PGLMALEVPEPLSEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEV NDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPI KLRKSMWKDRNLDVVRKKQKEKKKLGLR
Predicted Disorder Regions 5 disordered segments; (2-34), (63-95), (112-123), (320-326), (429-448)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Fukuda T, Naiki T, Saito M, Irie K. hnRNP K interacts with RNA binding motif protein 42 and functions in the maintenance of cellular ATP level during stress conditions. Genes Cells. 2009 Feb;14(2):113-28. doi: 10.1111/j.1365-2443.2008.01256.x. Epub 2008 Jan 6. PMID: 19170760.