Search by BoMiProt ID - Bomi8888


Primary Information

BoMiProt ID Bomi8888
Protein Name RNA polymerase II-associated protein 1
Organism Bos taurus
Uniprot IdA0JN53
Milk FractionWhey
Ref Sequence Id NP_001071452.1
Aminoacid Length 1395
Molecular Weight 152859
Fasta Sequence https://www.uniprot.org/uniprot/A0JN53.fasta
Gene Name RPAP1
Gene Id 531362
Protein Existence Status reviewed

Secondary Information

Protein Function The RNA polymerase II-associated protein 1 (RPAP1) is conserved across metazoa and required for stem cell differentiation in plants.RPAP1 is essential for the expression of cell identity genes and for cell viability. RPAP1 is essential for the interaction between RNA polymerase II (RNA Pol II) and Mediator, as well as for the recruitment of important regulators, such as the Mediator-specific RNA Pol II factor Gdown1 and the C-terminal domain (CTD) phosphatase RPAP2.
Biochemical Properties RPAP1 is a large (153-kDa) multidomain protein with a high degree of conservation across species.Studies in plants, yeasts, and mammals indicate that RPAP1 interacts with the RPB3 (official name POLR2C) and RPB11 (POLR2J) subunits of the RNA Pol II complex. Importantly, the heterodimer RPB3/RPB11 provides a critical interface of RNA Pol II with the Mediator complex.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A0JN53|RPAP1_BOVIN RNA polymerase II-associated protein 1 OS=Bos taurus OX=9913 GN=RPAP1 PE=2 SV=1 MLSRPKPGESEVDLLRFQSQFLAAGATPAVQLVKKGSRRAGDANLEQPPLQDHRDVVMLD SLPDLPPALVPAPPKRARPSPGHLLPEHEDPEERLHRHDQHITAVLTKIIERDTSSMPVN LPVSSGVAFPPVFHRSQGRQGKPVTAGKRSIFAQEIAARRASGAKVSPVREVESILDPPE SAMTCEALTPREWGSQPPWNSYSFQGPHLVTGKGLKGQEAEQEAQTIHEENVARLQALAP EEILQEQQRLLAQLDPSLVAFLKSHSCTREQAEEKATREQRPGRPSAEVIGKEAIAPTSA SVPRQENELEPETPALALPVT*321PQKEWLHMDTVELEKLHWTQDLPPLRRQQTQERMQARFS LQGELLAPDMDLPTHLGLHHHGEEAERAGYSLQELFHLTRSQVSQQRALALHVLAQVIGR AQAGEFGDRLVGSVLHLLLDAGFLFLLRFSLDDRVDGVIAAAVRALRALLVAPGDEELLD STFSWYHGALMFALMPSQEDKEDEDEDEEPPAEKAKTKSPEEGNRPPSDLARHDIIKGLL ATNLLPRLRYVLEVTCPGPSVVLDILTVLIRLARHSLESATRVLECPRLVETVVREFLPT SWSPMGSGPTSSLHRVPCAPAMKLLRVLASASRNIAARLLSGFDLRSRLSRFIAEDPQDL ALPLEEAETLSTEAFRLWAVAASYGLGSDLYRELYPVLMQALQDVPKELSSPPPRPLAVQ RIASLLTLLTQLTLAAGHIAPEHNSHSAEASLLAGSSSVTWTQVSGLQPLVEPCLRQTLK LLPRPEMWSALGPVPTACLLFLDAYYQAWSQQPGLCPEDWLQDMERLSEGLLLPLLKHPS LGSLWDSLGCCSPLCNPQSCAVAPETISSLASLGCAGGHPPLSLAGSASPFPFLTALLSL LNTLGRIHKGLCGQLATVLAAPGLQDYFLRCVAPVAALHLTPFSAWALRHEYHLQYLALT LAQRAATLQPPMSGTDAALCHGMALALLGRLLPGSEHLAHELMLSCVFRLEFLPERASGG PEAADFSDRLSLGSGGDLGCGRGALLAQACQDLPSIRSCYLTHCSLARASLLASQALYRG ELQRVPALLLPVPKEPLLPTDWPFLPLIQLYHRASDTPSGLPPADTVGTALRALQWVLVL ESWRPRALWAVSPAARLARLMCVFLVDSELFRETPIQRLVAALLARLCQPEVLSNLNLDC PLPGLTSFPDLYANFLEHFEAVSFGDHLFGALILLPLQRRFSVTLRLALFGEHVGALRAL GLPLTQLPVSLECYTAPPEDNLALLQLYFRALVTGALRPRWCPVLYAVAVAHVNSFIFSQ DPNNSDEIKAACRSMLQKTWLLTDEGLRQHLLHYKLPNSALPEGFELYPQLPPLRQQYLQ KLRISGVLPNGVSDT
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Depletion of RPAP1 triggers cell de-differentiation, facilitates reprogramming toward pluripotency, and impairs differentiation. Direct interactions with stomatal transcription factors provide a novel mechanism by which RPAP proteins may control differentiation of cell types and tissues in eukaryotes.
Bibliography 1.Lynch CJ, Bernad R, Calvo I, Nóbrega-Pereira S, Ruiz S, Ibarz N, Martinez-Val A, Graña-Castro O, Gómez-López G, Andrés-León E, Espinosa Angarica V, Del Sol A, Ortega S, Fernandez-Capetillo O, Rojo E, Munoz J, Serrano M. The RNA Polymerase II Factor RPAP1 Is Critical for Mediator-Driven Transcription and Cell Identity. Cell Rep. 2018 Jan 9;22(2):396-410. doi: 10.1016/j.celrep.2017.12.062. PMID: 29320736; PMCID: PMC5775503. 2.Chen L, Zhao M, Wu Z, Chen S, Rojo E, Luo J, Li P, Zhao L, Chen Y, Deng J, Cheng B, He K, Gou X, Li J, Hou S. RNA polymerase II associated proteins regulate stomatal development through direct interaction with stomatal transcription factors in Arabidopsis thaliana. New Phytol. 2021 Apr;230(1):171-189. doi: 10.1111/nph.17004. Epub 2020 Nov 23. PMID: 33058210.