Search by BoMiProt ID - Bomi8887


Primary Information

BoMiProt ID Bomi8887
Protein Name RNA polymerase II-associated factor 1 homolog
Organism Bos taurus
Uniprot IdQ2KJ14
Milk FractionWhey
Ref Sequence Id NP_001039758.1
Aminoacid Length 532
Molecular Weight 60280
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJ14.fasta
Gene Name PAF1
Gene Id 528744
Protein Existence Status Reviewed 

Secondary Information

Protein Function role in transcrpition elongation. Pol II-associated factor 1 (PAF1) modulates the release of paused Pol II into productive elongation.
PTMs Phosphorylation,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJ14|PAF1_BOVIN RNA polymerase II-associated factor 1 homolog OS=Bos taurus OX=9913 GN=PAF1 PE=2 SV=1 MAPTIQTQAQREDGHRPNSHRTLPERSGVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQ YKATSLEKQHKHDLLTEPDLGVTIDLINPDTYRIDPNVLLDPADEKLLEEEIQAPTS*117SKR SQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIE KTFEDAQKSISQHYSKPRVTPVEVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEM MSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVK NKASKGYEENYFFIFREGDGVYYNELETRVRLSKRRAKAGVQSGTNALLVVKHRDMNEKE LEAQEARKAQLENHEPEEEEEEEMETEEKEAGASDEEREKGSSSEKEGSEDERSGSESER EEGDRDEASDKSGSGEDESSEDEARAARDKEEIFGS*456DADSEDDADSDDEDRGRARGSDND SDSGSDGGGQRSRSHSRSRSASPFPSGSEHSAQEDGSEAAASDSSEADSDSD
Predicted Disorder Regions 1-26, 111-125, 233-235, 335-532
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs  CNOT4 may control the expression or activity of unidentified E3 ligases or deubiquitinases that target PAF1 for ubiquitination.PAF1 is poly-ubiquitinated and degraded via the 26S proteasome.CNOT4 plays a key role in the regulation of PAFc-mediated gene expression.
Bibliography Sun HY, Kim N, Hwang CS, Yoo JY. Protein Degradation of RNA Polymerase II-Association Factor 1(PAF1) Is Controlled by CNOT4 and 26S Proteasome. PLoS One. 2015 May 1;10(5):e0125599. doi: 10.1371/journal.pone.0125599. PMID: 25933433; PMCID: PMC4416890.