Primary Information |
---|
BoMiProt ID | Bomi8860 |
---|
Protein Name | RNA demethylase ALKBH5/Alkylated DNA repair protein alkB homolog 5/Alpha-ketoglutarate-dependent dioxygenase alkB homolog 5 |
---|
Organism | Bos taurus |
---|
Uniprot Id | E1BH29 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001192446.1 |
---|
Aminoacid Length | 394 |
---|
Molecular Weight | 44097 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/E1BH29.fasta |
---|
Gene Name | ALKBH5 |
---|
Gene Id | 533303 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Dioxygenase,demethylates RNA by oxidative demethylation.specifically demethylates N6-methyladenosine (m6A) RNA. |
---|
Biochemical Properties | Requires molecular oxygen, alpha-ketoglutarate and iron.Binds 1 Fe2+ per subunit. |
---|
PTMs | Acetylation, Isopeptide bond formation, phosphorylation, Ubl conjugation,Sumoylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|E1BH29|ALKB5_BOVIN RNA demethylase ALKBH5 OS=Bos taurus OX=9913 GN=ALKBH5 PE=3 SV=1
MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYAAPGVKRKY
PEDS*64DPERS*69DFEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYN
EHTVDRAPLRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHR
VIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVS
EPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRLETKSLSSS
VLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRSVLLPAHRRAG
RFSSENYRRKS*371YEPGEDCSEAAGS*384PARKVKMRRH
|
---|
Predicted Disorder Regions | 1-11, 20-25, 49-81, 147-160, 292-343, 343-345, 358-394 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | phosphorylation at serine residues S87 and S325 by ERK/JNK.ALKBH5 phosphorylation facilitates ALKBH5 SUMOylation by promoting the interaction between ALKBH5 and SUMO E2 UBC9. ALKBH5 is modified by SUMO-1 mainly at lysine residues K86 and K321, which is mediated by the SUMO E3 ligase PIAS4. |
---|
Bibliography | Li N, Kang Y, Wang L, Huff S, Tang R, Hui H, Agrawal K, Gonzalez GM, Wang Y, Patel SP, Rana TM. ALKBH5 regulates anti-PD-1 therapy response by modulating lactate and suppressive immune cell accumulation in tumor microenvironment. Proc Natl Acad Sci U S A. 2020 Aug 18;117(33):20159-20170. doi: 10.1073/pnas.1918986117. Epub 2020 Aug 3. PMID: 32747553; PMCID: PMC7443867. |