Search by BoMiProt ID - Bomi8860


Primary Information

BoMiProt ID Bomi8860
Protein Name RNA demethylase ALKBH5/Alkylated DNA repair protein alkB homolog 5/Alpha-ketoglutarate-dependent dioxygenase alkB homolog 5
Organism Bos taurus
Uniprot IdE1BH29
Milk FractionWhey
Ref Sequence Id NP_001192446.1
Aminoacid Length 394
Molecular Weight 44097
Fasta Sequence https://www.uniprot.org/uniprot/E1BH29.fasta
Gene Name ALKBH5
Gene Id 533303
Protein Existence Status reviewed

Secondary Information

Protein Function Dioxygenase,demethylates RNA by oxidative demethylation.specifically demethylates N6-methyladenosine (m6A) RNA.
Biochemical Properties Requires molecular oxygen, alpha-ketoglutarate and iron.Binds 1 Fe2+ per subunit.
PTMs Acetylation, Isopeptide bond formation, phosphorylation, Ubl conjugation,Sumoylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BH29|ALKB5_BOVIN RNA demethylase ALKBH5 OS=Bos taurus OX=9913 GN=ALKBH5 PE=3 SV=1 MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYAAPGVKRKY PEDS*64DPERS*69DFEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYN EHTVDRAPLRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHR VIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVS EPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRLETKSLSSS VLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRSVLLPAHRRAG RFSSENYRRKS*371YEPGEDCSEAAGS*384PARKVKMRRH
Predicted Disorder Regions 1-11, 20-25, 49-81, 147-160, 292-343, 343-345, 358-394
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs phosphorylation at serine residues S87 and S325 by ERK/JNK.ALKBH5 phosphorylation facilitates ALKBH5 SUMOylation by promoting the interaction between ALKBH5 and SUMO E2 UBC9. ALKBH5 is modified by SUMO-1 mainly at lysine residues K86 and K321, which is mediated by the SUMO E3 ligase PIAS4.
Bibliography Li N, Kang Y, Wang L, Huff S, Tang R, Hui H, Agrawal K, Gonzalez GM, Wang Y, Patel SP, Rana TM. ALKBH5 regulates anti-PD-1 therapy response by modulating lactate and suppressive immune cell accumulation in tumor microenvironment. Proc Natl Acad Sci U S A. 2020 Aug 18;117(33):20159-20170. doi: 10.1073/pnas.1918986117. Epub 2020 Aug 3. PMID: 32747553; PMCID: PMC7443867.