Search by BoMiProt ID - Bomi8815


Primary Information

BoMiProt ID Bomi8815
Protein Name RING finger protein 11
Organism Bos taurus
Uniprot IdQ08DI6
Milk FractionWhey
Ref Sequence Id NP_001071421.1
Aminoacid Length 154
Molecular Weight 17444
Fasta Sequence https://www.uniprot.org/uniprot/Q08DI6.fasta
Gene Name RNF11
Gene Id 522791
Protein Existence Status reviewed

Secondary Information

Protein Function role in in growth factor signalling, ubiquitination and transcriptional regulation.RNF11 is capable of enhancing TGFβ signalling directly and by inhibition of Smurf2-mediated downregulation of the TGFβ signal.Has a pro-apoptotic effect on cells that remain sensitive to DNA damage-induced apoptosis or TGFβ-induced apoptosis .
Biochemical Properties  has modular domains and motifs including a RING-H2 finger domain, a PY motif, an ubiquitin interacting motif (UIM), a 14-3-3 binding sequence and an AKT phosphorylation site.
PTMs Lipidation, Myristoylation, Palmitoylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DI6|RNF11_BOVIN RING finger protein 11 OS=Bos taurus OX=9913 GN=RNF11 PE=2 SV=1 MGNCLKSPTSDDIS*14LLHESQSDRAS*25FGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLAT QLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHI YHLDCIDDWLMRSFT*135CPSCMEPVDAALLSSYETN
Predicted Disorder Regions 1-66, 151-154
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs phosphorylation may modulate its activity.when it is bound by ubiquitin 14-3-3 related to its normal function and intracellular localisation of the RNF11 protein. In order to confer 14-3-3 binding to RNF11, the threonine within this site is phosphorylated by AKT.RNF11 function is negatively regulated by AKT phosphorylation and 14-3-3 binding.
Bibliography Azmi P, Seth A. RNF11 is a multifunctional modulator of growth factor receptor signalling and transcriptional regulation. Eur J Cancer. 2005 Nov;41(16):2549-60. doi: 10.1016/j.ejca.2005.08.020. Epub 2005 Oct 13. PMID: 16226459.