Search by BoMiProt ID - Bomi8813


Primary Information

BoMiProt ID Bomi8813
Protein Name RING finger protein 10
Organism Bos taurus
Uniprot IdQ08E13
Milk FractionWhey
Ref Sequence Id NP_001070337.1
Aminoacid Length 810
Molecular Weight 89716
Fasta Sequence https://www.uniprot.org/uniprot/Q08E13.fasta
Gene Name RNF10
Gene Id 520757
Protein Existence Status reviewed

Secondary Information

Protein Function RING finger protein 10 prevents neointimal hyperplasia by promoting apoptosis.It is also a potential drug target for diabetic vascular complications.
Biochemical Properties Ring finger protein 10 (RNF10), a member of the RING finger family belonging to E3 ubiquitin ligase,With the function of recruiting E2 ligases and target proteins, it was reported to be involved in hyperproliferation, apoptosis, cell differentiation, neuronal development and other biological processes.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08E13|RNF10_BOVIN RING finger protein 10 OS=Bos taurus OX=9913 GN=RNF10 PE=2 SV=1 MPQSS*5PSAAATASDMDKNSGSSSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSSGS KRYNRKREPSYPKNENFINQSRRSNSQKSKTFNKMPPQRGGGSSKLFSSS*110FNGGRRDEVA EAQRAEFS*128PAQFSGPKKINLNHLLNFTFEPRGQAGHFEGSGHGSWGKRNKWGHKPFNKEL FLQANCQFVVSEDQDYTVHFADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRC GHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKSVVATESRQYVVGDTITMQLMKRE KGVLVALPKSKWMNVDHPIHLGDEQHSQYSKLLLASKEQVLRRVVQEEKAALERQLAEEK HTPESCFIEAAIQELKAREEALSGLAESRGEVPGVVAALEQRVLMAPLAKESVFQPRKGV LEYLSAFDEDATEVCSLGPPHPVALPLVEEEETVSEPEPEGLSEACEDLELVEDNLGEGT ICTESSQQEPVSKPSVTHLSSSPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLEQSPEKI SATVVEISGYSMSEDMRQRHRYLSHLPLTCEFSICELALQPPLVSKETLEIFSDDIEKRK RQRQKKAREERRRERRIEMEENKKQGKYPEVHIPLENLQQFPAFNSYTCSSDSALGSTST EGRGALSLSPLSRSPGSQADFLLTPLSPTASQGSPSFCVGSLEEDSPFPSFAQMLRVGKA KADVWPKTAPKKDENTLGPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKLDTPVT SDPLSEEKGGKKRKKQKQKLLFSTSVVHTK
Predicted Disorder Regions 1-65, 448-477, 644-704, 745-810
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Acetylation and Deacetylation at Lys-131 and Deacetylation is by SIRT2; which does not change methyltransferase activity.
Additional Comments Reduced RING finger protein 10 expression in macrophages is associated with aging-related inflammation.
Bibliography 1.Li S, Yu G, Huang W, Wang R, Pu P, Chen M. RING finger protein 10 is a potential drug target for diabetic vascular complications. Mol Med Rep. 2019 Aug;20(2):931-938. doi: 10.3892/mmr.2019.10358. Epub 2019 Jun 6. PMID: 31173254; PMCID: PMC6625204. 2.Yu G, Chen J, Li S, Pu P, Huang W, Zhao Y, Peng X, Wang R, Lei H. RING finger protein 10 prevents neointimal hyperplasia by promoting apoptosis in vitro and in vivo. Life Sci. 2018 Sep 1;208:325-332. doi: 10.1016/j.lfs.2018.04.055. Epub 2018 Apr 30. PMID: 29723537. 3.Seki, N, Hattori, A, Sugano, S, Muramatsu, M & Saito, T (2000) cDNA cloning, expression profile, and genomic structure of human and mouse RNF10/Rnf 10 genes, encoding a novel RING finger protein. J Hum Genet. 45, 38-42 . 4.Dinamarca, MC, Guzzetti, F, Karpova, A, Lim, D, Mitro, N, Musardo, S, Mellone, MMarcello, E, Stanic, J, Samaddar, T, Burguiere, A, Caldarelli, A, Genazzani, AA, Perroy, J, Fagni, L, Canonico, PL, Kreutz, MR, Gardoni, F & Di Luca, M (2016) Ring finger protein 10 is a novel synaptonuclear messenger encoding activation of NMDA receptors in hippocampus. #N/A. 5,e12430.