Search by BoMiProt ID - Bomi8808


Primary Information

BoMiProt ID Bomi8808
Protein Name Ribosome biogenesis regulatory protein homolog
Organism Bos taurus
Uniprot IdQ2KIH4
Milk FractionWhey
Ref Sequence Id NP_001068949.1
Aminoacid Length 365
Molecular Weight 41427
Fasta Sequence https://www.uniprot.org/uniprot/Q2KIH4.fasta
Gene Name RRS1
Gene Id 510956
Protein Existence Status reviewed

Secondary Information

Protein Function ribosome biogenesis.RRS1 interacts with RPF2 to form a complex that regulates the maturation of the 60S ribosomal subunit
PTMs Acetylation, Citrullination, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KIH4|RRS1_BOVIN Ribosome biogenesis regulatory protein homolog OS=Bos taurus OX=9913 GN=RRS1 PE=2 SV=1 MEGQS*5VEELLAKAERDEAEKLQRITVLKELELEFDLGNLLASDRNPPTGLRHAGPTQEAE LRALARDNTQLLINQLWQLPTERVEEALVARLPEPSTRLPREKPVPRPRPLTRWQQFARL KGIRPKKKTNLVWDEVSGRWRRRWGYQRARDDTKEWLIEVPGNADPMEDQFAKRIQAKKE RVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQSKEELGRAMQVAKVSTASVGRFQERLP KEKAPRGSGKKRKFQPLFGDFAAERKSQLEMLRVMNSKKPQMDITRATNKQMREEDQEEA AKRRKMSQKGKRKGGRQGPGSKRKGGTPSQGGKRKGGLGGKMNSGPPGLSGKRKGGQHQG GKRRK
Predicted Disorder Regions 1-20, 38-65, 87-365
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments RRS1 functions as an oncogene in Retinoblastoma via activating the AKT/mTOR signaling pathway.
Bibliography Yan X, Wu S, Liu Q, Zhang J. RRS1 Promotes Retinoblastoma Cell Proliferation and Invasion via Activating the AKT/mTOR Signaling Pathway. Biomed Res Int. 2020 Nov 2;2020:2420437. doi: 10.1155/2020/2420437. PMID: 33204686; PMCID: PMC7652605.