Search by BoMiProt ID - Bomi8807


Primary Information

BoMiProt ID Bomi8807
Protein Name Ribosome biogenesis protein WDR12/WD repeat-containing protein 12
Organism Bos taurus
Uniprot IdQ0VC24
Milk Fractionwhey
Ref Sequence Id NP_001069375.1
Aminoacid Length 423
Molecular Weight 47709
Fasta Sequence https://www.uniprot.org/uniprot/Q0VC24.fasta
Gene Name WDR12
Gene Id 528209
Protein Existence Status Reviewed

Secondary Information

Protein Function Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VC24|WDR12_BOVIN Ribosome biogenesis protein WDR12 OS=Bos taurus OX=9913 GN=WDR12 PE=2 SV=1 MAQLQTRFFTDNKKYAVDDVPFSIPAASEIADLSNLINKLLEAKNEFHKHVEFDFLIKGQ FLRMPLFKHMELENISSEEVVELEYVEKYTAPQPEQCMFHDDWISAIEGTEEWILTGSYD KTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNKVK ALHCCRGHAGSVDSIAVDSTGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKT EQLGLTRTPIVTLSGHKEAISSVLWSDAEEICSASWDHTIKVWDVESGSLKSTLTGNKVF NCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKWSPTHEQQLIS GSLDNMVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDSGLLLSGGADNKLYSYRYS*415PTTSH VGA
Predicted Disorder Regions 224-242, 420-423
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166