Primary Information |
|---|
| BoMiProt ID | Bomi8792 |
|---|
| Protein Name | Ribosomal L1 domain-containing protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A4FV97 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 482 |
|---|
| Molecular Weight | 53076 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RSL1D1 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | a novel senescence-associated gene.Acts as pro-apoptotic regulator in response to DNA damage.participates in ribosome biosynthesis or acts as a transcriptional cofactor.Can regulate the activity of nucleostemin which delays the aging progression in mouse fibroblasts.RSL1D1 interacted with RAN and inhibited its deacetylation by competitively binding with Sirt7. By affecting the acetylation of RAN, RSL1D1 inhibited the accumulation of nuclear STAT3 and the STAT3-regulated autophagic program. |
|---|
| Biochemical Properties | C-terminal (residues 317–452) is imp for binding to nucleostamin for age delaying process.contains part of the ribosomal L1p/L10e consensus sequence in its N-terminus and a long lysine-rich domain in its C-terminus,which is the target for CRC. |
|---|
| PTMs | Acetylation,Phosphorylation,Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A4FV97|RL1D1_BOVIN Ribosomal L1 domain-containing protein 1 OS=Bos taurus OX=9913 GN=RSL1D1 PE=2 SV=1
MEASASNPPSTSPETSASTPETPPGPEQLDEEQVKKAVEALLAHSRSRKNANGLLLNENE
NFFLMVVLWKIPSKELRVRLSLPHGIRSDLADVCLFTKDEPNLSSEQTERYYKKLLNNHG
IKTISQIIPFRTLKKEYKAYEAKLRLLGSFDFFITDARIRRLLPSHLGRHFYNRKKVPVS
VNLQSKTLSREINDCIGGTVLNISKSGSCSTIRIGHTGMPIQHIVENVVAVAKSLSQKLP
EKWESVKLLFVKTERSVSLPVFSSFVSSQGEAKGLRTRDLLKKVSKKSRKKTERALKRQQ
EKKEKKLLKQAAKAKPAPTTDAVAPKTGGVPTQDPAPQEETGGVSALPKAQDDS*354EDEIPL
LVPLKET*367PAAGSTKIQKAAIGKKS*384PKKS*388PGPNTARAKKRKASPALET*407PIAAEPKT*415PGKGPGKKARVKEEVEKERNSSLGKKDPRQTPKKPEAKFFTT*457ASSS*461VKKAPRTLTQRPKKPKVPQ
ST
|
|---|
| Predicted Disorder Regions | 1-37, 47-52, 269-482 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | acetylated RSL1D1 protein interacts with Sirt7 and is deacetylated by Sirt7. |
|---|
| Bibliography | 1.Liu X, Chen J, Long X, Lan J, Liu X, Zhou M, Zhang S, Zhou J. RSL1D1 promotes the progression of colorectal cancer through RAN-mediated autophagy suppression. Cell Death Dis. 2022 Jan 10;13(1):43. doi: 10.1038/s41419-021-04492-z. PMID: 35013134; PMCID: PMC8748816. 2.Ma L, Zhao W, Zheng Q, Chen T, Qi J, Li G, Tong T. Ribosomal L1 domain and lysine-rich region are essential for CSIG/ RSL1D1 to regulate proliferation and senescence. Biochem Biophys Res Commun. 2016 Jan 15;469(3):593-8. doi: 10.1016/j.bbrc.2015.12.004. Epub 2015 Dec 12. PMID: 26686419. |