Search by BoMiProt ID - Bomi8784


Primary Information

BoMiProt ID Bomi8784
Protein Name Ribonuclease P protein subunit p30/RNaseP protein p30/RNase P subunit 2
Organism Bos taurus
Uniprot IdQ3SZ21
Milk FractionWhey
Ref Sequence Id NP_001030538.1
Aminoacid Length 268
Molecular Weight 29395
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZ21.fasta
Gene Name RPP30/RNASEP2
Gene Id 615098
Protein Existence Status reviewed

Secondary Information

Protein Function Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. 
Biochemical Properties Ribonuclease P protein subunit p30 (RPP30), a component of ribonuclease P (RNase P), generates mature tRNA molecules by cleaving the 5'-end.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZ21|RPP30_BOVIN Ribonuclease P protein subunit p30 OS=Bos taurus OX=9913 GN=RPP30 PE=2 SV=1 MAVFADLDLRAGSDLKALRGLVENAAHLGYSVVAINHVVEFKEKKQEIEKPVAVSELFTT LPIVQGKSKPIKILTRLTIIVSDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL DVDLVCITVTEKLPFYFKRPPINVAIDRGVGFELLYSPAIKDSTMRRYTISNALNLMQVC KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAVLLHGETRKTAFG IISTVKKPRTS*251EADDDSLPACKKAKCES
Predicted Disorder Regions 248-268
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Li G, Zhai Y, Liu H, Wang Z, Huang R, Jiang H, Feng Y, Chang Y, Wu F, Zeng F, Jiang T, Zhang W. RPP30, a transcriptional regulator, is a potential pathogenic factor in glioblastoma. Aging (Albany NY). 2020 Jul 23;12(16):16155-16171. doi: 10.18632/aging.103596. Epub 2020 Jul 23. PMID: 32702667; PMCID: PMC7485703.