Search by BoMiProt ID - Bomi8779


Primary Information

BoMiProt ID Bomi8779
Protein Name Ribonuclease H2 subunit B/Ribonuclease HI subunit B/RNase H2 subunit B
Organism Bos taurus
Uniprot IdQ3ZBI3
Milk FractionWhey
Ref Sequence Id NP_001160038.1
Aminoacid Length 309
Molecular Weight 35008
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBI3.fasta
Gene Name RNASEH2B
Gene Id 509258
Protein Existence Status reviewed

Secondary Information

Protein Function plays an essential role for genome stability as it removes ribonucleotides misincorporated into genomic DNA by replicative polymerases and resolves RNA/DNA hybrids.
Biochemical Properties cleave the RNA moiety in RNA/DNA hybrids.RNase H2 can also hydrolyze the 5′-phosphodiester bond of a single ribonucleotide embedded in a DNA duplex.The human RNase H2 forms a heterotrimeric complex consisting of the catalytic RNase H2A subunit, which is characterized by a metal binding DEDD motif (D24, E35, D141, D169), and two auxiliary subunits RNase H2B and RNase H2C.The auxiliary B and C subunits adopt an interwoven triple β-barrel folded together with the C-terminal extension of the A subunit located on the C-terminal half of RNase H2C .
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBI3|RNH2B_BOVIN Ribonuclease H2 subunit B OS=Bos taurus OX=9913 GN=RNASEH2B PE=2 SV=2 MARGADGGDGASVWQHVFLLPEYLKDDSKKMKSGLVFVKLANPCSGEGTIYLFNMCLPQL FEIKVFKEKNHSWFINESVQSGGLLHFATPVDPLFLLLHYLIKADKESFQGKFQPLDQVV MDDMFPDCILLLKLPELEKLLQHVTEEKEVDKKKYYKYSKEKTLKWLGKKVNQTMAALKT NKVNVSARVQSTAFFSGGQVSSDKDEDYVRYAHGLISDYIPKQLSDDLSKYLKLPEPPAS VRNPPSKKAKLSDEPVMAKEDYTKFNSKDFKTVKKNSKMTAAQKALAKVDKSGMKS*296IDSF FGTKHVKKK
Predicted Disorder Regions 1-8, 26-36, 233-309
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Biallelic mutations in the genes encoding the three RNase H2 subunits cause Aicardi-Goutières syndrome (AGS), an early-onset inflammatory encephalopathy
Bibliography 1.Kind B, Muster B, Staroske W, Herce HD, Sachse R, Rapp A, Schmidt F, Koss S, Cardoso MC, Lee-Kirsch MA. Altered spatio-temporal dynamics of RNase H2 complex assembly at replication and repair sites in Aicardi-Goutières syndrome. Hum Mol Genet. 2014 Nov 15;23(22):5950-60. doi: 10.1093/hmg/ddu319. Epub 2014 Jun 30. PMID: 24986920. 2.Kind B, Muster B, Staroske W, Herce HD, Sachse R, Rapp A, Schmidt F, Koss S, Cardoso MC, Lee-Kirsch MA. Altered spatio-temporal dynamics of RNase H2 complex assembly at replication and repair sites in Aicardi-Goutières syndrome. Hum Mol Genet. 2014 Nov 15;23(22):5950-60. doi: 10.1093/hmg/ddu319. Epub 2014 Jun 30. PMID: 24986920.