Primary Information |
---|
BoMiProt ID | Bomi8776 |
---|
Protein Name | Rho-related GTP-binding protein RhoB |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3ZBW5 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_001071390.1 |
---|
Aminoacid Length | 196 |
---|
Molecular Weight | 22123 |
---|
FASTA Sequence |
Download |
---|
Gene Name | RHOB |
---|
Gene ID | 515118 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | ureter |
---|
Protein Function | Normally it mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Ras and Rho-related GTP-binding proteins can activate MAPK or JNK in a variety of cell lines. |
---|
PTMs | Lipoylation, Methylation, Palmitoylation, Phosphorylation at Tyr, Prenylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBW5|RHOB_BOVIN Rho-related GTP-binding protein RhoB OS=Bos taurus OX=9913 GN=RHOB PE=2 SV=1
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKD
LRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAY*154DYLECSAKTKEGVREVFETATRAALQ
KRYGSQNGCINCCKVL
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Prenylation specifies the subcellular location of RHOB. The farnesylated form is localized to the plasma membrane while the geranylgeranylated form is localized to the endosome |
---|
Bibliography | 1.Teramoto H, Crespo P, Coso OA, Igishi T, Xu N, Gutkind JS. The small GTP-binding protein rho activates c-Jun N-terminal kinases/stress-activated protein kinases in human kidney 293T cells. Evidence for a Pak-independent signaling pathway. J Biol Chem. 1996 Oct 18;271(42):25731-4. doi: 10.1074/jbc.271.42.25731. PMID: 8824197. |