Search by BoMiProt ID - Bomi8776


Primary Information

BoMiProt ID Bomi8776
Protein Name Rho-related GTP-binding protein RhoB
Organism Bos taurus
Uniprot IdQ3ZBW5
Milk FractionExosomes
Ref Sequence Id NP_001071390.1
Aminoacid Length 196
Molecular Weight 22123
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBW5.fasta
Gene Name RHOB
Gene Id 515118
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells ureter 
Protein Function Normally it mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Ras and Rho-related GTP-binding proteins can activate MAPK or JNK in a variety of cell lines.
PTMs Lipoylation, Methylation, Palmitoylation, Phosphorylation at Tyr, Prenylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBW5|RHOB_BOVIN Rho-related GTP-binding protein RhoB OS=Bos taurus OX=9913 GN=RHOB PE=2 SV=1 MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKD LRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAY*154DYLECSAKTKEGVREVFETATRAALQ KRYGSQNGCINCCKVL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Prenylation specifies the subcellular location of RHOB. The farnesylated form is localized to the plasma membrane while the geranylgeranylated form is localized to the endosome 
Bibliography 1.Teramoto H, Crespo P, Coso OA, Igishi T, Xu N, Gutkind JS. The small GTP-binding protein rho activates c-Jun N-terminal kinases/stress-activated protein kinases in human kidney 293T cells. Evidence for a Pak-independent signaling pathway. J Biol Chem. 1996 Oct 18;271(42):25731-4. doi: 10.1074/jbc.271.42.25731. PMID: 8824197.