Search by BoMiProt ID - Bomi8725


Primary Information

BoMiProt ID Bomi8725
Protein Name Retinal guanylyl cyclase 1/Guanylate cyclase 2D, retinal/Guanylate cyclase E/Rod outer segment membrane guanylate cyclase
Organism Bos taurus
Uniprot IdP55203
Milk FractionWhey
Aminoacid Length 1110
Molecular Weight 120369
Fasta Sequence https://www.uniprot.org/uniprot/P55203.fasta
Gene Name GUCY2D
Protein Existence Status reviewed

Secondary Information

Protein Function It facilitates the cGMP synthesis in photoreceptors of eyes i.e. rods and cones. It also has crucial role in phototransduction and it does so by mediating replineshment of cGMP.
Significance in milk phototransduction
PTMs Disulphide bond, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P55203|GUC2D_BOVIN Retinal guanylyl cyclase 1 OS=Bos taurus OX=9913 GN=GUCY2D PE=1 SV=1 MTACTFLAGGLRDPGLCGPTRWAPSPPGLPPIPPRPRLRLRPPLLLLLLLPRSVLSAVFT VGVLGPWACDPIFARARPDLAARLAASRLNHAAALEGGPRFEVALLPEPCRTPGSLGAVS SALTRVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAAGTTAPVVTPAADALYAL LRAFRWAHVALVTAPQDLWVEAGHALSTALRARGLPVALVTSMEPSDLSGAREALRRVQD GPRVRAVIMVMHSVLLGGEEQRCLLEAAEELGLADGSLVFLPFDTLHYALSPGPDALAVL AN*302SSQLRKAHDAVLTLTRHCPLGGSVRDSLRRAQEHRELPLDLNLQQVSPLFGTIYDSVF LLAGGVARARVAAGGGWVSGAAVARHIRDARVPGFCGALGGAEEPSFVLLDTDATGDQLF ATYVLDPTQGFFHSAGTPVHFPKGGRGPGPDPSCWFDPDTICNGGVEPSVVFIGFLLVVG MGLAGAFLAHYCRHRLLHIQMVSGPNKIILTLDDITFLHPHGGNSRKVAQGSRTSLAARS ISDVRSIHSQLPDYTNIGLYEGDWVWLKKFPGDRHIAIRPATKMAFSKIRELRHENVALY LGLFLAGGAGGPAAPGEGVLAVVSEHCARGSLQDLLAQRDIKLDWMFKSSLLLDLIKGIR YLHHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPSAEDQLWTAPELLR DPVLERRGTLAGDVFSLGIIMQEVVCRSAPYAMLELTPEEVVKRVQSPPPLCRPSVSIDQ APMECIQLMKQCWAEQPELRPSMDRTFELFKSINKGRKMNIIDSMLRMLEQYSSNLEDLI RERTEELELEKQKTDRLLTQMLPPSVAEALKMGTPVEPEYFEEVTLYFSDIVGFTTISAM SEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGHRHAAEIANMALD ILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASAMESTGLP YRIHVNRSTVQILSALNEGFLTEVRGRTELKGKGAEETYWLVGRRGFNKPIPKPPDLQPG ASNHGISLHEIPPDRRQKLEKARPGQFSGK
Predicted Disorder Regions (22-36), (1100-1110)
DisProt Annotation
TM Helix Prediction 2TMHs; (470-492),(596-614)
Significance of PTMs N-linked glycosylation of asparagine at 302 position.
Bibliography Goraczniak, R. M., Duda, T., Sitaramayya, A., & Sharma, R. K. (1994). Structural and functional characterization of the rod outer segment membrane guanylate cyclase. The Biochemical journal, 302 ( Pt 2)(Pt 2), 455–461. https://doi.org/10.1042/bj3020455