Search by BoMiProt ID - Bomi8707


Primary Information

BoMiProt ID Bomi8707
Protein Name Replication initiator 1
Organism Bos taurus
Uniprot IdQ0VCC5
Milk FractionWhey
Ref Sequence Id NP_001068989.1
Aminoacid Length 559
Molecular Weight 62372
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCC5.fasta
Gene Name REPIN1
Gene Id 511510
Protein Existence Status reviewed

Secondary Information

Protein Function Participare in initiation of DNA replication.REPIN1 appears to be involved in the regulation of cell size and glucose transport in adipocytes
Biochemical Properties Acts as TF, binds to the DNA consensus sequence 5-prime-CAGCTG-3-prime.567-amino acid long.contains 15 C2H2 zinc finger DNA-binding motifs which are organized into 3 clusters.A proline-rich region is located between ZF8 and ZF9.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCC5|REPI1_BOVIN Replication initiator 1 OS=Bos taurus OX=9913 GN=REPIN1 PE=2 SV=1 MLERRCRGPVAMGPAQPRLLSGPSQES*27PQT*30LEKEPQGLRSRGTAAAQSGGQALGRAHRCA HCRRHFPGWVALWLHARRCQARLPRPCPECGRRFRHAPFLALHCQVHAAATPDQGFACHL CGQSFRGWVALVLHLRAHSAAKRPIACPACERRFWRRKQLRAHSRRCHPPAPEARPFICG NCGRSFAQWDQLVTHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGGDAVDRPFQCAC CGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPCTECGRR FRHKPNLLSHSKIHKRSEGSAQGGPQPPASAPERTPEPPPEPAPEPAEVPVGPGQPSAAA EAPPSLHTCADCGRGFRLERFLRAHQRQHGGERPFACAECGKHFGKKTHLVAHSRVHSGE RPFACEECGRRFSQGSHLAAHRRDHAPERPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYV CPECGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAIC GQTFDDEGKLLAHQKKHDV
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Ruschke K, Illes M, Kern M, Klöting I, Fasshauer M, Schön MR, Kosacka J, Fitzl G, Kovacs P, Stumvoll M, Blüher M, Klöting N. Repin1 maybe involved in the regulation of cell size and glucose transport in adipocytes. Biochem Biophys Res Commun. 2010 Sep 17;400(2):246-51. doi: 10.1016/j.bbrc.2010.08.049. Epub 2010 Aug 19. PMID: 20727851.