Search by BoMiProt ID - Bomi8704


Primary Information

BoMiProt ID Bomi8704
Protein Name RELT-like protein 2
Organism Bos taurus
Uniprot IdQ2KI80
Milk FractionWhey
Ref Sequence Id NP_001039768.1
Aminoacid Length 303
Molecular Weight 32269
Fasta Sequence https://www.uniprot.org/uniprot/Q2KI80.fasta
Gene Name RELL2
Gene Id 529327
Protein Existence Status reviewed

Secondary Information

Protein Function Induces activation of MAPK14/p38 cascade, when overexpressed. Induces apoptosis, when overexpressed.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KI80|RELL2_BOVIN RELT-like protein 2 OS=Bos taurus OX=9913 GN=RELL2 PE=2 SV=1 MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGS*52EPDDAQLQ PPEDDDMNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSSAPCIHCSRNKRPPLVRQGRSKEGKSRPRPGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQDPGGGQGPGGGQPRTGMPAIESLPPERPQPPALASTPMQNG GLRDSSRVPRALEGNPGASAEPMLGAGGRGPSPGPARKEANGQPSKQDTSDHQVSPPRGA GGV
Predicted Disorder Regions 2 disordered segments; (1-12), (41-303)
DisProt Annotation
TM Helix Prediction 1TMH; (15-37)