Search by BoMiProt ID - Bomi8696


Primary Information

BoMiProt ID Bomi8696
Protein Name Regulator of microtubule dynamics protein 2/Protein FAM82A1
Organism Bos taurus
Uniprot IdQ2TBQ7
Milk FractionWhey
Ref Sequence Id NP_001035598.1
Aminoacid Length 410
Molecular Weight 47067
Fasta Sequence https://www.uniprot.org/uniprot/Q2TBQ7.fasta
Gene Name RMDN2/FAM82A/ FAM82A1
Gene Id 506362
Protein Existence Status reviewed

Secondary Information

PTMs Phosphorylation
Linking IDs Bomi8696
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TBQ7|RMD2_BOVIN Regulator of microtubule dynamics protein 2 OS=Bos taurus OX=9913 GN=RMDN2 PE=2 SV=2 MPHSTNREMILGIVVGTAGISLLLLWYHKVRKPRTAMSLPKFLSLGNSLDLMTLQDEMPS GQGTTAIFQGRQLQILEKLNELLTHMEELKEEIRVLKEAIPKLEEYIQGELGGKVTVHKI S*121PQHRARKRRLATVQSSAT*139SNSSEEAESEGGY*152VT*154ANT*157DTEEQSFPVPKEFNTHVEELNLDALIQRADNLRVNESRKVESFELLCDHKEKFRDEIEFIWRFARAYGDMYELSTNIQEKKHY ANIGKTLGEKAIMRAPKNGYCHLWYAVLCGYVSEFEGLQNKINYGYRFKEHLDKAIEFLP EEPFLYYLKGRYCYAVSKLSWIERKMAATLFGNIPSSTVQEALQNFLKVEELQPGFSKSN YMFMAKCYADLNQIDSAMKFCNLAVLLPCITKEDKDAQKEVKKISTSLKR
Predicted Disorder Regions 55-62, 118-174, 394-410
DisProt Annotation
TM Helix Prediction 1TMH; (9-27)
Linking IDs