Search by BoMiProt ID - Bomi8690


Primary Information

BoMiProt ID Bomi8690
Protein Name Regulator of G-protein signaling 19
Organism Bos taurus
Uniprot IdQ08DC7
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001070383.1
Aminoacid Length 223
Molecular Weight 25353
Fasta Sequence https://www.uniprot.org/uniprot/Q08DC7.fasta
Gene Name RGS19
Gene Id 539036
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  leukocyte 
Protein Function Regulator of G protein signaling 19 (RGS19) has recently been shown to inhibit Ras activation by upregulating the tumor metastasis suppressor Nm23.
PTMs Lipoylation, Palmitoylation, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DC7|RGS19_BOVIN Regulator of G-protein signaling 19 OS=Bos taurus OX=9913 GN=RGS19 PE=2 SV=1 MPTPPEAEKQQTGPEEADQPPSMS*24SHDAAPPAPPRRNPCCLCWCCCCSCSWNEERRRAWR ASRESRLQPLPSCEVCATPTPTPTPTPEEVRSWAQSFDKLMHS*103PAGRSVFREFLRTEYSE ENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILS*157PKEVSLDSRVREGINKKMQEPSA HTFDDAQLQIYTLMHRDSYPRFLSSPAYRALLLQGASQSSSEA
Predicted Disorder Regions 1-32, 69-92
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs  Heavily palmitoylated in the cysteine string motif.
Additional Comments Elevated expression of RGS19 in HEK293 cells has been shown to impair the responsiveness of JNK and p38 mitogen-activated protein kinase (MAPK) as well as their upstream GTPases Rac1 and Cdc42.
Bibliography 1.Wang Y, Tong Y, Tso PH, Wong YH. Regulator of G protein signaling 19 suppresses Ras-induced neoplastic transformation and tumorigenesis. Cancer Lett. 2013 Oct 1;339(1):33-41. doi:10.1016/j.canlet.2013.07.025. Epub 2013 Jul 30. PMID: 23911936. 2.A.K.C. Ip, P.H. Tso, M.M.K. Lee, Y.H. Wong.Elevated expression of RGS19 impairs the responsiveness of stress-activated protein kinases to serum.Mol. Cell. Biochem., 362 (2012), pp. 159-168.