Primary Information |
---|
BoMiProt ID | Bomi8690 |
---|
Protein Name | Regulator of G-protein signaling 19 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q08DC7 |
---|
Milk Fraction | Exosomes,MFGM |
---|
Ref Sequence Id | NP_001070383.1 |
---|
Aminoacid Length | 223 |
---|
Molecular Weight | 25353 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q08DC7.fasta |
---|
Gene Name | RGS19 |
---|
Gene Id | 539036 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | leukocyte |
---|
Protein Function | Regulator of G protein signaling 19 (RGS19) has recently been shown to inhibit Ras activation by upregulating the tumor metastasis suppressor Nm23. |
---|
PTMs | Lipoylation, Palmitoylation, Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08DC7|RGS19_BOVIN Regulator of G-protein signaling 19 OS=Bos taurus OX=9913 GN=RGS19 PE=2 SV=1
MPTPPEAEKQQTGPEEADQPPSMS*24SHDAAPPAPPRRNPCCLCWCCCCSCSWNEERRRAWR
ASRESRLQPLPSCEVCATPTPTPTPTPEEVRSWAQSFDKLMHS*103PAGRSVFREFLRTEYSE
ENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILS*157PKEVSLDSRVREGINKKMQEPSA
HTFDDAQLQIYTLMHRDSYPRFLSSPAYRALLLQGASQSSSEA
|
---|
Predicted Disorder Regions | 1-32, 69-92 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Heavily palmitoylated in the cysteine string motif. |
---|
Additional Comments | Elevated expression of RGS19 in HEK293 cells has been shown to impair the responsiveness of JNK and p38 mitogen-activated protein kinase (MAPK) as well as their upstream GTPases Rac1 and Cdc42. |
---|
Bibliography | 1.Wang Y, Tong Y, Tso PH, Wong YH. Regulator of G protein signaling 19 suppresses Ras-induced neoplastic transformation and tumorigenesis. Cancer Lett. 2013 Oct 1;339(1):33-41. doi:10.1016/j.canlet.2013.07.025. Epub 2013 Jul 30. PMID: 23911936. 2.A.K.C. Ip, P.H. Tso, M.M.K. Lee, Y.H. Wong.Elevated expression of RGS19 impairs the responsiveness of stress-activated protein kinases to serum.Mol. Cell. Biochem., 362 (2012), pp. 159-168. |