Search by BoMiProt ID - Bomi8665


Primary Information

BoMiProt ID Bomi8665
Protein Name Receptor expression-enhancing protein 4
Organism Bos taurus
Uniprot IdQ3ZCI8
Milk FractionWhey
Ref Sequence Id NP_001029705.1
Aminoacid Length 257
Molecular Weight 29597
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZCI8.fasta
Gene Name REEP4
Gene Id 519613
Protein Existence Status reviewed

Secondary Information

Protein Function promotes Nuclear pore complex(NPC) assembly and appears to be particularly important for NPC formation during mitosis. ensure proper cell division and nuclear envelope reassembly,they clear ER from metaphase chromosomes in a microtubule-dependent manner.Essential for the normal, high curvature ER morphology during mitosis.
Biochemical Properties contains RHD domain which is important for the formation of high curvature ER during mitosis through their RHDs. C-terminus is required to promote normal high curvature ER morphology during metaphase
PTMs phosphorylation on Ser and thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZCI8|REEP4_BOVIN Receptor expression-enhancing protein 4 OS=Bos taurus OX=9913 GN=REEP4 PE=2 SV=1 MVSWMICRLVVLVFGMLYPAYASYKAVKTKNIREYVRWMMYWIVFALFMAVETFTDIFIS WFPFYYEIKMAFVLWLLSPYTRGASMLYRKFVHPSLSRHEKEIDTYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGKLRSFS*152MQDLRTIPDGPAPTYQDPLYLEDQVPHR RPPIGYRAGGLRDS*194DT*196DNECWS*202DTEVVPQPPARPREKPLGRSQSLRVIKRKPLAREGTSR SLKVRTRKKT*250APS*253DMDS
Predicted Disorder Regions 153-257
DisProt Annotation
TM Helix Prediction 2TMHs; (4-22), (42-64)
Bibliography Kumar D, Golchoubian B, Belevich I, Jokitalo E, Schlaitz AL. REEP3 and REEP4 determine the tubular morphology of the endoplasmic reticulum during mitosis. Mol Biol Cell. 2019 Jun 1;30(12):1377-1389. doi: 10.1091/mbc.E18-11-0698. Epub 2019 Apr 17. PMID: 30995177; PMCID: PMC6724692.