Search by BoMiProt ID - Bomi8634


Primary Information

BoMiProt ID Bomi8634
Protein Name Ras GTPase-activating protein 3
Organism Bos taurus
Uniprot IdQ28013
Milk FractionExosomes
Aminoacid Length 834
Molecular Weight 95386
Fasta Sequence https://www.uniprot.org/uniprot/Q28013.fasta
Gene Name RASA3
Protein Existence Status Reviewed

Secondary Information

Protein Function RASA3 (or GTPase Activating Protein III, R-Ras GTPase-activating protein, GAP1(IP4BP)) is a GTPase activating protein of the GAP1 subfamily which targets Ras and Rap1. 
Biochemical Properties The RASA3 protein structure is identical in man and mouse: 2 C2 domains, C2A and C2B, at the N-terminal end of the protein, a central GTPase activating protein (GAP) catalytic domain and a carboxy-terminal pleckstrin homology (PH) domain followed by a Bruton tyrosine kinase (Btk) motif, named the PH/Btk domain. Interestingly, the RASA3 central catalytic domain contains a GAP consensus sequence, F-L-R-X3-P-A-X3-P, which is active on both Ras and Rap1, but not on members of the Rab, Rac or Rho family
PTMs N-acetylation at Ala,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q28013|RASA3_BOVIN Ras GTPase-activating protein 3 OS=Bos taurus OX=9913 GN=RASA3 PE=2 SV=1 MAVEEEGLRVFQSVKIKIGEAKNLPTYPGPNKMRDCYCTVNLDQEEVFRTKVVEKSLCPF YGEDFY*66CEIPRSFRHLS*77FYIFDRDVFRRDSIIGKVAIKKEDLQKYHNRDT*110WFQLQHVDAD SEVQGKVHLELRLSEVITDSGVVCHKLATRILECQGLPIVNGQCDPYATVTLAGPCRSEA KKTKVKKKTNNPQFDEVFYFEVTRPCSYSRKSHFDFEDEDVDKLEIRVDLWNASNLKFGD EFLGELRVPLKVLRQSSPHEAWYFLQPRDNGSKSLKPGDLGSLRLNVVYTEDHVFSSDYY SPLRDLLLKSADVEPVSASAAHILGEVCREKQEAAIPLVRLFLHYGRVVPFISAIASAEV RRTQDPNTIFRGNSLTSKCIDETMKLAGMQYLHVTLKPTIEEICQSHKSCEIDPVRLKDG ESLESNMENLRQFVDRVFSVITKSGVSCPTVMCDIFFSLREAAAKRFQDDLDVRYTAVSS FIFLRFFAPAILSPNLFQLTPHHTDPQTSRTLTLVSKTIQTLGSLSKSKSASFKESYMAA FYEFFNEQKYADAVKNFLDLISSSGRRDPKSVQQPILLKEGFMIKRAQGRKRFGMKNFKK RWFRLTNHEFTYQKSKGDPPLYSIPIENILAVEPLEEESFKMKNMFQVIQPERALYIQAN NCVEAKAWIDILTKVSQCNQKRLAVYHPSAYLNGHWLCCRASSDTAAGCSPCTGGLPANI QLDIDGDRETERIYSLSSSYMSKLETMQEACGSRSVYDGPEQEEYSTFIIDDPQETYKTL KQVVAGVGALEQEHAQYKRDKFRRTKYGS*809QEHPIGDKSFQSYIRQQSETPAHS*833M
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Schurmans S, Polizzi S, Scoumanne A, Sayyed S, Molina-Ortiz P. The Ras/Rap GTPase activating protein RASA3: from gene structure to in vivo functions. Adv Biol Regul. 2015 Jan;57:153-61. doi: 10.1016/j.jbior.2014.09.006. Epub 2014 Sep 28. PMID: 25294679. 2.P.J. Cullen, J.J. Hsuan, A.J. Letcher, T.R. Jackson, A.P. Dawson, R.F. Irvine.Identification of a specific Ins(1,3,4,5)P4-binding protein as a member of the GAP1 family.Nature, 376 (1995), pp. 527-530. 3.M. Fukuda, K. Mikoshiba.The function of inositol high polyphosphate binding proteins.BioEssay, 19 (2006), pp. 593-603.