Search by BoMiProt ID - Bomi8621


Primary Information

BoMiProt ID Bomi8621
Protein Name Ran-binding protein 10/RanBP10
Organism Bos taurus
Uniprot IdA3KMV8
Milk FractionWhey
Ref Sequence Id NP_001091594.1
Aminoacid Length 620
Molecular Weight 67249
Fasta Sequence https://www.uniprot.org/uniprot/A3KMV8.fasta
Gene Name RANBP10
Gene Id 519736
Protein Existence Status Reviewed

Secondary Information

Protein Function May act as an adapter protein to couple membrane receptors to intracellular signaling pathways. Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1.
PTMs Acetylation, phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A3KMV8|RBP10_BOVIN Ran-binding protein 10 OS=Bos taurus OX=9913 GN=RANBP10 PE=2 SV=1 MAAATADPGAGSPQVGDSSGGATGCGLPSPGEQELSRRLQRLYPAVNQHETPLPRSWSPK DKYNYIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGI GLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTC FYTKNGHSLGIAFTDLPANLYPTVGLQTPGEIVDANFGQQPFLFDIEDYMREWRAKVQGT VHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFARMTETPIQEEQASIKNRQKIQK LVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRSLSSRSPKSQDS*361Y*362PGS*365PS*367LS*369PRHGPTSSHTHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSSSSS*422PSSVNYSESNSTDSTKSQPHSSTSNQETS*451DS*453EMEMEAEHYPNGVLESMSTRIVNGAYKHEDLQTDESSMDDGHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKDLAHTEMLQ DAFSLLAYSDPWSCPVGQQLDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLR LMARAGLGSCSFARVDDYLH
Predicted Disorder Regions 1-29, 44-58, 77-89, 357-478,
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Hou, J., Liu, Y., Huang, P., Wang, Y., Pei, D., Tan, R., Zhang, Y., & Cui, H. (2021). RANBP10 promotes glioblastoma progression by regulating the FBXW7/c-Myc pathway. Cell death & disease, 12(11), 967. https://doi.org/10.1038/s41419-021-04207-4