Search by BoMiProt ID - Bomi8601


Primary Information

BoMiProt ID Bomi8601
Protein Name Radial spoke head protein 3 homolog/A-kinase anchor protein RSPH3/Radial spoke head-like protein 2
Organism Bos taurus
Uniprot IdA8E4N3
Milk FractionWhey,MFGM
Ref Sequence Id NP_001103269.1
Aminoacid Length 606
Molecular Weight 68700
Fasta Sequence https://www.uniprot.org/uniprot/A8E4N3.fasta
Gene Name RSPH3/RSHL2
Gene Id 533135
Protein Existence Status reviewed

Secondary Information

Protein Function Members of the heat-shock protein (HSP)40 regulate the protein folding activity of HSP70 proteins and help the functional specialization of this molecular chaperone system in various types of cellular events.Radial spokes are structurally conserved, macromolecular complexes that are essential for the motility of 9 + 2 motile cilia.
PTMs Phosphorylation at Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A8E4N3|RSPH3_BOVIN Radial spoke head protein 3 homolog OS=Bos taurus OX=9913 GN=RSPH3 PE=2 SV=1 MARSEARRQAREKRPRAVPEERALRERRQPRPRREPLESGAGDHRRPPQASAGAAGHASF MRRLVDQEDAGGQSQEPEVLGRTGNLPRKPASRNSPEAPPLDGTLGCWATGAGAAGGFGG AQNRACVAPTSCPGNLPARPLPFLPPLLASRNPCPWHYVHLSGSHDTLVPTCFEAKLHQK GSGPTPSATSTLAERASPAMATYTYTSRPRALPCQRRRYRDDLMQQPEEPVHYGNIMYDR RVIRGNTYALQSVPLPGQPDPVEIQRQQQARRRAFARKQAQEQLRPRTPEPVEGRKHVDV QTELYLEEIADRIVEVDMECQTDAFLDKPPT*331PLFIPAKTGKDVATEILEGELFDFDLEVK PMLEVLVGKTIEQSLLEVMEEEELANLRASQYAYEELRNIELAEVQRLEEQERRHREEKE RRKQQQWQVVHKHNETSQKIAARAFAQRYLADLLPSVFDSLRDGGYFYDPVERDIEIGFL PWLMNEVDKTMESSMVGRTVLDMLIREVVERRLNLYEQKEGRHASVRPENGLGGPGGTRE PLVGFESQDQGASQAQRPLPDRDSLQRTPYDARYAERVSSQERRLAEENDELTEMRKSSK REELSQ
Predicted Disorder Regions 1-18, 70-84, 121-131, 228-241, 266-290, 544-581
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments In Chlamydomonas species, mutations in radial spoke proteins result in ciliary motility defects. 
Bibliography 1.Han X, Xie H, Wang Y, Zhao C. Radial spoke proteins regulate otolith formation during early zebrafish development. FASEB J. 2018 Jul;32(7):3984-3992. doi: 10.1096/fj.201701359R. Epub 2018 Feb 22. PMID: 29475374. 2.Satouh Y, Padma P, Toda T, Satoh N, Ide H, Inaba K. Molecular characterization of radial spoke subcomplex containing radial spoke protein 3 and heat shock protein 40 in sperm flagella of the ascidian Ciona intestinalis. Mol Biol Cell. 2005 Feb;16(2):626-36. doi: 10.1091/mbc.e04-09-0784. Epub 2004 Nov 24. PMID: 15563603; PMCID: PMC545899.