Primary Information |
|---|
| BoMiProt ID | Bomi8590 |
|---|
| Protein Name | RAC-alpha serine/threonine-protein kinase/Protein kinase B |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q01314 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_776411.1 |
|---|
| Aminoacid Length | 480 |
|---|
| Molecular Weight | 55748 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | AKT1 |
|---|
| Gene ID | 280991 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. |
|---|
| PTMs | Acetylation, Disulfide bond, Glycoprotein, Isopeptide bond, Phosphoprotein, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus OX=9913 GN=AKT1 PE=1 SV=2
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDLEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGS*124PGENS*129*129GAEEMEVSLAKPKHRVTMNDFEYLKLLGKGTFGKVILVKEKATGRYY*176AMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKEVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGAT*305MKT*308FCGT*312PEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMIT*448IT*450PPDQDDSMEGVDSERRPHFPQFS*473 *473Y*474SASATA
|
|---|
| Predicted Disorder Regions | 44-47, 99-142, 437-480 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | O-GlcNAcylation at Ser-473 also probably interferes with phosphorylation at this site.Phosphorylation on Thr-308, Ser-473 and Tyr-474 is required for full activity.Acetylation results in reduced phosphorylation and inhibition of activity.Cleaved at the caspase-3 consensus site Asp-462 during apoptosis, resulting in down-regulation of the AKT signaling pathway and decreased cell survival. |
|---|
| Additional Comments | The overexpression of Akt1 (RAC-alpha serine/threonine-protein Kinase) is a hallmark of Oral Squamous Cell Carcinoma (OSCC). |
|---|
| Bibliography | 1.Sharif Siam MK, Sarker A, Sayeem MMS. In silico drug design and molecular docking studies targeting Akt1 (RAC-alpha serine/threonine-protein kinase) and Akt2 (RAC-beta serine/threonine-protein kinase) proteins and investigation of CYP (cytochrome P450) inhibitors against MAOB (monoamine oxidase B) for OSCC (oral squamous cell carcinoma) treatment. J Biomol Struct Dyn. 2021 Oct;39(17):6467-6479. doi: 10.1080/07391102.2020.1802335. Epub 2020 Aug 4. PMID: 32746771. |
|---|
