Search by BoMiProt ID - Bomi8590


Primary Information

BoMiProt ID Bomi8590
Protein Name RAC-alpha serine/threonine-protein kinase/Protein kinase B
Organism Bos taurus
Uniprot IdQ01314
Milk FractionExosomes
Ref Sequence Id NP_776411.1
Aminoacid Length 480
Molecular Weight 55748
Fasta Sequence https://www.uniprot.org/uniprot/Q01314.fasta
Gene Name AKT1
Gene Id 280991
Protein Existence Status Reviewed

Secondary Information

Protein Function AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis.
PTMs Acetylation, Disulfide bond, Glycoprotein, Isopeptide bond, Phosphoprotein, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus OX=9913 GN=AKT1 PE=1 SV=2 MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDLEQRESPLNNFSVAQC QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF RSGS*124PGENS*129*129GAEEMEVSLAKPKHRVTMNDFEYLKLLGKGTFGKVILVKEKATGRYY*176AMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS RERVFSEDRARFYGAEIVSALDYLHSEKEVVYRDLKLENLMLDKDGHIKITDFGLCKEGI KDGAT*305MKT*308FCGT*312PEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK LSPPFKPQVTSETDTRYFDEEFTAQMIT*448IT*450PPDQDDSMEGVDSERRPHFPQFS*473 *473Y*474SASATA
Predicted Disorder Regions 44-47, 99-142, 437-480
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs O-GlcNAcylation at Ser-473 also probably interferes with phosphorylation at this site.Phosphorylation on Thr-308, Ser-473 and Tyr-474 is required for full activity.Acetylation results in reduced phosphorylation and inhibition of activity.Cleaved at the caspase-3 consensus site Asp-462 during apoptosis, resulting in down-regulation of the AKT signaling pathway and decreased cell survival.
Additional Comments The overexpression of Akt1 (RAC-alpha serine/threonine-protein Kinase) is a hallmark of Oral Squamous Cell Carcinoma (OSCC). 
Bibliography 1.Sharif Siam MK, Sarker A, Sayeem MMS. In silico drug design and molecular docking studies targeting Akt1 (RAC-alpha serine/threonine-protein kinase) and Akt2 (RAC-beta serine/threonine-protein kinase) proteins and investigation of CYP (cytochrome P450) inhibitors against MAOB (monoamine oxidase B) for OSCC (oral squamous cell carcinoma) treatment. J Biomol Struct Dyn. 2021 Oct;39(17):6467-6479. doi: 10.1080/07391102.2020.1802335. Epub 2020 Aug 4. PMID: 32746771.