Search by BoMiProt ID - Bomi8586


Primary Information

BoMiProt ID Bomi8586
Protein Name Rabphilin-3A/Exophilin-1
Organism Bos taurus
Uniprot IdQ06846
Milk FractionWhey
Ref Sequence Id NP_776879.1
Aminoacid Length 704
Molecular Weight 77978
Fasta Sequence https://www.uniprot.org/uniprot/Q06846.fasta
Gene Name RPH3A
Gene Id 282044
Protein Existence Status Reviewed

Secondary Information

Protein Function Plays an essential role in docking and fusion steps of regulated exocytosis.
PTMs Phosphorylation,acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q06846|RP3A_BOVIN Rabphilin-3A OS=Bos taurus OX=9913 GN=RPH3A PE=1 SV=1 MTDTVFSSSSSRWMCPSDRPLQSNDKEQLQTGWSVHPSGQPDRQRKQEELTDEEKEIINR VIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKK NVCTKCGVETSNNRPHPVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKNKPQQ PVSEPVPAAPEPATPEPKHPARAPTRGDTEDRRGPGQKTGPDMTSAPGRGSYGPPVRRAS EARMSSSGRDSDSWDQGHGMAAGDPSQSPAGLRRANS*277VQASRPAPASMQSPAPPQPGQPG PPGGSRPSPGPTGRFPDQRPEVAPSDPDYTGAAAQPREERTGGIGGYSAAGTREDRAGHP PGSYTQASAAAPQPVVASARQPPPPEEDEEEANSYDSDEATTLGALEFSLLYDQDNSSLH CTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITD EDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGS ARGMALYEEEQVERIGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFV KLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDY IGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNENHVS*702S*703D
Predicted Disorder Regions 22-49, 235-324, 364-398,
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs During genotoxic stress,RANBP10 is subjected to post-translational modifications. For example, S361, S365, and S369 are phosphorylated following ionizing radiation.RANBP10 K293 is acetylated following UV radiation.
Additional Comments RANBP10 knockout mice have a mild platelet deficit due to microtubule functional anomalies
Bibliography 1.Shirataki, H., Kaibuchi, K., Sakoda, T., Kishida, S., Yamaguchi, T., Wada, K., Miyazaki, M., & Takai, Y. (1993). Rabphilin-3A, a putative target protein for smg p25A/rab3A p25 small GTP-binding protein related to synaptotagmin. Molecular and cellular biology, 13(4), 2061–2068. https://doi.org/10.1128/mcb.13.4.2061-2068.1993 2.Palmieri D, Tessari A, Coppola V. Scorpins in the DNA Damage Response. Int J Mol Sci. 2018 Jun 17;19(6):1794. doi: 10.3390/ijms19061794. PMID: 29914204; PMCID: PMC6032341.