Search by BoMiProt ID - Bomi8584


Primary Information

BoMiProt ID Bomi8584
Protein Name Rab-like protein 6/GTP-binding protein Parf/Rab-like protein 1/RBEL1
Organism Bos taurus
Uniprot IdQ08DA0
Milk FractionWhey,exosome
Ref Sequence Id NP_001070285.1
Aminoacid Length 701
Molecular Weight 77097
Fasta Sequence https://www.uniprot.org/uniprot/Q08DA0.fasta
Gene Name RABL6/PARF
Protein Existence Status Reviewed

Secondary Information

Protein Function Rab-like protein 6 may be involved in enhancement of cellular proliferation and reduction of growth inhibitory activity of CDKN2A
Biochemical Properties RABL6 is a member of the Ras subfamily which are made up of small GTPases.
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DA0|RABL6_BOVIN Rab-like protein 6 OS=Bos taurus OX=9913 GN=RABL6 PE=2 SV=1 MFSALKKLVGSEQAPGRDRNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALW HRLQGKKFVEEYIPTQEIQVTSIHWSYKTTDDVVKVEVWDVVDKGKCKKRGDGLKMENDP QEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDM GEHRVILPDDVRDVLDHLDRPPGSSYFRYAESSMKNSFGLKYLHRFFNIPFLQLQRETLL RQLETNQLDIDATLEELSVQQETEDQNYDIFLEMMEARSRGHASPLTTSGQSPSSGSQSP VVPPSTVSTGSSSPSTPQPVLQPPLQAPPAPPAPAEAPPLPAAPPRRSIIARLFGSTPAT EAAPPPPEPTPAAEASQKVQNVEDFVPEDSLDGS*394FLEDTVPAKDEKRLGARGPQDS*416DS*418DR ETQAGNPMVAGFQDDVDLEDKPPSRPLPPTGPVPSEDITLS*461S*462EEEAEEGAGHPKAAVLAP QKCPEPETRRSSTKALGPPRDAAPRAAKPRPEGPSGKLEEGTDKPVSSESDAEGPIAAQM LSFVMDDPDFES*552DSDAQRRAGEFPVREDLS*570DLT*573DEDAGPVQPPAPPKPLAPSFRLKDDSD LFGLGLEEPGREDS*614S*615EQDKEGRPPAKEKKKKKKKGREEEDKAAKKRSKHKKSRERADDKG RDERRRRPRGPQRTALDELEAFLGGGAPSGPLRGGGDYEAL
Predicted Disorder Regions 12-21, 263-339, 368-508, 540-600, 621-660
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments knocking down of RABL6 in osteosarcoma cells also impaired cell colony formation and proliferation
Bibliography 1.Feng, Y., Yan, S., Huang, Y. et al. High expression of RABL6 promotes cell proliferation and predicts poor prognosis in esophageal squamous cell carcinoma. BMC Cancer 20, 602 (2020). https://doi.org/10.1186/s12885-020-07068-w 2.Tang, H., Ji, F., Sun, J., Xie, Y., Xu, Y., & Yue, H. (2016). RBEL1 is required for osteosarcoma cell proliferation via inhibiting retinoblastoma 1. Molecular medicine reports, 13(2), 1275–1280. https://doi.org/10.3892/mmr.2015.4670