Search by BoMiProt ID - Bomi8553


Primary Information

BoMiProt ID Bomi8553
Protein Name Pyrroline-5-carboxylate reductase 1, mitochondrial/P5C reductase 1/P5CR 1
Organism Bos taurus
Uniprot IdQ58DT4
Milk FractionWhey
Ref Sequence Id NP_001014957.1
Aminoacid Length 320
Molecular Weight 33454
Fasta Sequence https://www.uniprot.org/uniprot/Q58DT4.fasta
Gene Name PYCR1
Gene Id 539606
Protein Existence Status Reviewed

Secondary Information

Protein Function  proline biosynthesis.response to oxidative stress
Biochemical Properties Can utilize both NAD and NADP, but has higher affinity for NAD. converts pyrroline-5-carboxylate to proline
Significance in milk important amino acid for the mammary secretory process, especially casein synthesis.
PTMs acetylation on ser,phosphorylation on ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58DT4|P5CR1_BOVIN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Bos taurus OX=9913 GN=PYCR1 PE=2 SV=1 MSVGFIGAGQLAFALAKGFTAAGVVAAHKIMASSPDMDLATVSALRKMGVNLTHHNKETV QHSDVLFLAVKPHIIPFILDEIAANIEARHIVVSCAAGVTISSIEKKLTAFQPAPKVIRC MTNTPVVVREGATVYATGTHAQVEDGRLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLDSEQHPGQLKDNVCSPGGATIH ALHVLESGGFRSLLIKAVEASCTRTRELQSMADQEKVS*278PAAIKKTILDKVKLDSPPGTSL APSGHSKLLPRSMAPAGKQD
Predicted Disorder Regions 273-320
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Yeh GC, Harris SC, Phang JM. Pyrroline-5-carboxylate reductase in human erythrocytes. J Clin Invest. 1981 Apr;67(4):1042-6. doi: 10.1172/jci110115. PMID: 6894153; PMCID: PMC370662.