Search by BoMiProt ID - Bomi8539


Primary Information

BoMiProt ID Bomi8539
Protein Name Putative oxidoreductase GLYR1/Glyoxylate reductase 1 homolog/Nuclear protein NP60
Organism Bos taurus
Uniprot IdA4FUF0
Milk FractionWhey
Ref Sequence Id NP_001035658.2
Aminoacid Length 553
Molecular Weight 60556
Fasta Sequence https://www.uniprot.org/uniprot/A4FUF0.fasta
Gene Name GLYR1/NP60
Gene Id 539636
Protein Existence Status reviewed

Secondary Information

Protein Function Nucleosome-destabilizing factor that is recruited to genes during transcriptional activation. Facilitates Pol II transcription through nucleosomes. It can also bind to DNA in in-vitro condition.
PTMs Phosphorylation,Ubl conjugation,isopeptide bond formation
Linking IDs Bomi8539
Bibliography Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166
Protein Function Nucleosome-destabilizing factor that is recruited to genes during transcriptional activation. Facilitates Pol II transcription through nucleosomes. It can also bind to DNA in in-vitro condition.
PTMs Phosphorylation,Ubl conjugation,isopeptide bond formation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FUF0|GLYR1_BOVIN Putative oxidoreductase GLYR1 OS=Bos taurus OX=9913 GN=GLYR1 PE=2 SV=1 MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQL KPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHSSADDKNRRNSSEERSRP ISGDEKRKLS*130LSEGKVKKNMGEGKKRVPSGSSERGSKSPLKRAQEQS*167PRKRGRPPKDEKD LSIPESSTVKGMMAGPMATFKWQPNVSEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLK ICEEETGSTSIQAADSTAVNGSVTPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTA EKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDM STVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAM GKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASI FLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQS*540 DNDMSAVYRAYIH
Predicted Disorder Regions (96-216)
DisProt Annotation
TM Helix Prediction no TM helices
Linking IDs
Bibliography Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166