Search by BoMiProt ID - Bomi8538


Primary Information

BoMiProt ID Bomi8538
Protein Name Putative monooxygenase p33MONOX
Organism Bos taurus
Uniprot IdQ3T044
Milk FractionWhey
Ref Sequence Id NP_001029497.1
Aminoacid Length 305
Molecular Weight 32987
Fasta Sequence https://www.uniprot.org/uniprot/Q3T044.fasta
Gene Name P33MONOX
Gene Id 508617
Protein Existence Status reviewed

Secondary Information

Protein Function Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth 
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T044|P33MX_BOVIN Putative monooxygenase p33MONOX OS=Bos taurus OX=9913 GN=P33MONOX PE=2 SV=1 MASRQPEVPALEPSGPLGKMSLPIGMYRRAFSYDDALEDPTPMT*44PPPSDMGSIPWKPVIP ERKYQDLAKVEEGEPSVSPPAPAPPPATDSAEKAPVVKAKATHVIMSSLITKQTQESIQR FEQQAGLRDAGYTPHKGLTTEETKYLRVAEALHKLKLQSGETAREERQPASTQST*175PSSSP QAS*183PKQKSRGWFTSGSATALPGPSLSTMDSGSGDKDRSSADKWSLFGPRSLQKSESGGFA IQAYKGAQKPSPMEVMRAQATRRAEEPATFKPPKMDIPVMEGTKQLPRAHSLKPRDLNVL TPTGF
Predicted Disorder Regions (1-305)
DisProt Annotation
TM Helix Prediction No TM helices