Primary Information |
---|
BoMiProt ID | Bomi8520 |
---|
Protein Name | Pulmonary surfactant-associated protein D/Lung surfactant protein D/PSP-D/SP-D |
---|
Organism | Bos taurus |
---|
Uniprot ID | P35246 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_851369.1 |
---|
Aminoacid Length | 369 |
---|
Molecular Weight | 37405 |
---|
FASTA Sequence |
Download |
---|
Gene Name | SFTPD |
---|
Gene ID | 282072 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | lung's defense against inhaled microorganisms, organic antigens and toxins. Extracellular reorganization or turnover of pulmonary surfactant. |
---|
Biochemical Properties | belongs to the collectin subgroup of C-type lectins.The polypeptide chain consists of a short N-terminal segment, participating in inter-chain disulfide bonding, a collagen-like region, an α-helical coiled-coil neck region and a C-terminal carbohydrate recognition domain (CRD). SP-D appear as cruci-formed tetramers. |
---|
Significance in milk | heavily expressed in the lung and the trachea but also in segments of the gastrointestinal tract, the mammary glands and the salivary glands. in bovines,function of lungs. |
---|
PTMs | Glycoprotein, Hydroxylation, S-nitrosylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus OX=9913 GN=SFTPD PE=1 SV=2
MLLLPLSVLLLLTQPWRSLGAEMKIYSQKTMANACTLVMCSPPEDGLPGRDGRDGREGPR
GEKGDPGSPGPAGRAGMPGPAGPIGLKGDN*90GSAGEPGPKGDTGPPGPPGMPGPAGREGPS
GKQGSMGPPGTPGPKGDTGPKGGVGAPGIQGSPGPAGLKGERGAPGEPGAPGRAGAPGPA
GAIGPQGPSGARGPPGLKGDRGTPGERGAKGESGLAEVNALRQRVGILEGQLQRLQNAFS
QYKKAMLFPNGRSVGEKIFKTEGSEKTFQDAQQICTQAGGQLPSPRSAAENEALTQLATA
QNKAAFLSMSDTRKEGTFIYPTGEPLVYSNWAPQEPNNDGGSENCVEIFPNGKWNDKVCG
EQRLVICEF
|
---|
Predicted Disorder Regions | (34-201) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | S-nitrosylation at Cys-35 and Cys-40 alters the quaternary structure which results in a pro-inflammatory chemoattractive signaling activity with macrophages. |
---|
Bibliography | Gjerstorff M, Madsen J, Bendixen C, Holmskov U, Hansen S. Genomic and molecular characterization of bovine surfactant protein D (SP-D). Mol Immunol. 2004 Jun;41(4):369-76. doi: 10.1016/j.molimm.2004.03.005. PMID: 15163533. |