Search by BoMiProt ID - Bomi8520


Primary Information

BoMiProt ID Bomi8520
Protein Name Pulmonary surfactant-associated protein D/Lung surfactant protein D/PSP-D/SP-D
Organism Bos taurus
Uniprot IdP35246
Milk FractionWhey
Ref Sequence Id NP_851369.1
Aminoacid Length 369
Molecular Weight 37405
Fasta Sequence https://www.uniprot.org/uniprot/P35246.fasta
Gene Name SFTPD
Gene Id 282072
Protein Existence Status reviewed

Secondary Information

Protein Function  lung's defense against inhaled microorganisms, organic antigens and toxins. Extracellular reorganization or turnover of pulmonary surfactant.
Biochemical Properties belongs to the collectin subgroup of C-type lectins.The polypeptide chain consists of a short N-terminal segment, participating in inter-chain disulfide bonding, a collagen-like region, an α-helical coiled-coil neck region and a C-terminal carbohydrate recognition domain (CRD). SP-D appear as cruci-formed tetramers.
Significance in milk heavily expressed in the lung and the trachea but also in segments of the gastrointestinal tract, the mammary glands and the salivary glands. in bovines,function of lungs.
PTMs Glycoprotein, Hydroxylation, S-nitrosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus OX=9913 GN=SFTPD PE=1 SV=2 MLLLPLSVLLLLTQPWRSLGAEMKIYSQKTMANACTLVMCSPPEDGLPGRDGRDGREGPR GEKGDPGSPGPAGRAGMPGPAGPIGLKGDN*90GSAGEPGPKGDTGPPGPPGMPGPAGREGPS GKQGSMGPPGTPGPKGDTGPKGGVGAPGIQGSPGPAGLKGERGAPGEPGAPGRAGAPGPA GAIGPQGPSGARGPPGLKGDRGTPGERGAKGESGLAEVNALRQRVGILEGQLQRLQNAFS QYKKAMLFPNGRSVGEKIFKTEGSEKTFQDAQQICTQAGGQLPSPRSAAENEALTQLATA QNKAAFLSMSDTRKEGTFIYPTGEPLVYSNWAPQEPNNDGGSENCVEIFPNGKWNDKVCG EQRLVICEF
Predicted Disorder Regions (34-201)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs S-nitrosylation at Cys-35 and Cys-40 alters the quaternary structure which results in a pro-inflammatory chemoattractive signaling activity with macrophages.
Bibliography Gjerstorff M, Madsen J, Bendixen C, Holmskov U, Hansen S. Genomic and molecular characterization of bovine surfactant protein D (SP-D). Mol Immunol. 2004 Jun;41(4):369-76. doi: 10.1016/j.molimm.2004.03.005. PMID: 15163533.