Search by BoMiProt ID - Bomi8519


Primary Information

BoMiProt ID Bomi8519
Protein Name Pulmonary surfactant-associated protein A
Organism Bos taurus
Uniprot IdQ6RXL1
Milk FractionWhey
Ref Sequence Id NP_001071306.2
Aminoacid Length 248
Molecular Weight 26381
Fasta Sequence https://www.uniprot.org/uniprot/Q6RXL1.fasta
Gene Name SFTPA1
Gene Id 407213
Protein Existence Status reviewed

Secondary Information

Protein Function Surfactant protein-A (SP-A) is a collectin protein expressed in airway epithelia that is critical in the modulation of both innate and adaptive immunity against inhaled pathogens.
PTMs Disulfide bond, Glycosylation, Hydroxylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q6RXL1|SFTPA_BOVIN Pulmonary surfactant-associated protein A OS=Bos taurus OX=9913 GN=SFTPA1 PE=2 SV=2 MLLCSLTLTLLWMVASGLECDVKEVCLGSPGIPGTPGSHGLPGRDGRDGIKGDPGPPGPM GPPGGMPGLPGRDGMTGAPGLPGERGEKGEPGERGPPGFPAYLDEELQGTLHEIRHQVLQ SQGVLRLQGSVLAVGEKVFSTNGQSVNFDAIKELCARVGGHIAAPRSPEENEAIVSIVKK YNTYAYLGLVEGPTAGDFYYLDGAPVN*207YTNWYPGEPRGRGKEKCVEIYTDGQWNDKNCLQ YRLAICEF
Predicted Disorder Regions 1 disordered segment; (20-99)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Chang EH. The role of surfactant protein-A in sinusitis. Curr Opin Allergy Clin Immunol. 2019 Feb;19(1):26-29. doi: 10.1097/ACI.0000000000000500. PMID: 30507715.