Search by BoMiProt ID - Bomi8495


Primary Information

BoMiProt ID Bomi8495
Protein Name Proto-oncogene c-Fos
Organism Bos taurus
Uniprot IdO77628
Milk Fractionwhey
Ref Sequence Id NP_877587.1
Aminoacid Length 380
Molecular Weight 40737
Fasta Sequence https://www.uniprot.org/uniprot/O77628.fasta
Gene Name FOS
Gene Id 280795
Protein Existence Status Reviewed

Secondary Information

Protein Function Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex, at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O77628|FOS_BOVIN Protein c-Fos OS=Bos taurus OX=9913 GN=FOS PE=2 SV=2 MMFSGFNADY*10EASSSRCSSASPAGDSLSYY*30HSPADSFSSMGSPVNAQDYCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAAT*232PESEEAFT LPLLNDPEPKPSVEPVKSVGSMELKAEPFDDYMFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCT*325PVVTCT*331PSCTTYTSSFVFTYPEADSFPSCAAAHRK GS*362SSNEPSSDSLSS*374PTLLAL
Predicted Disorder Regions 12-45, 90-157, 210-303, 320-326, 342-380
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated in the C-terminal upon stimulation by nerve growth factor (NGF) and epidermal growth factor (EGF). Constitutively sumoylated with SUMO1, SUMO2 and SUMO3.
Bibliography Herrera, D. G., & Robertson, H. A. (1996). Activation of c-fos in the brain. Progress in neurobiology, 50(2-3), 83–107. https://doi.org/10.1016/s0301-0082(96)00021-4