Search by BoMiProt ID - Bomi8494


Primary Information

BoMiProt ID Bomi8494
Protein Name Proton-coupled folate transporter/Heme carrier protein 1/Retinal pigment epithelium transporter/Solute carrier family 46 member 1
Organism Bos taurus
Uniprot IdQ05B81
Milk FractionExosomes
Ref Sequence Id NP_001073053.1
Aminoacid Length 459
Molecular Weight 50428
Fasta Sequence https://www.uniprot.org/uniprot/Q05B81.fasta
Gene Name SLC46A1
Gene Id 511097
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells retina and retinal pigment epithelium
Protein Function The proton-coupled folate transporter (PCFT-SLC46A1) is a protein by which folates are absorbed across the brush-border membrane of the small intestine.
Biochemical Properties PCFT has twelve transmembrane domains (TMDs) with their N- and C-termini directed to the cytoplasm.
PTMs N-acetylmethionine,N-Linked Glycosylation at Asn, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q05B81|PCFT_BOVIN Proton-coupled folate transporter OS=Bos taurus OX=9913 GN=SLC46A1 PE=2 SV=1 MEGRANSPGEPRAWPTRSVLCRGCVEPLVFLANFALVLQGPVTTQYLWHRFSADLGYN*58GT RHRDSCSN*68HSVDPIAQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDCVGRRPLLVLA SLGLLLQTVLSIFVVQLHLHIGYLVLGRILCALLGDFSGLLAASFASVADVSSSRTRTIR MALLEACIGVAGMLASFIGGFLLQEQVYVNPFWLALAVLTVMTLYAAFCFGETVKERTPT RLFTLRHHRSVIQLYVTQAPEKSRKHLALYSLAIFVMITVHLGAQDILTLYELSAPLCWD SRLISYGSAAQQLPYLTSLLGLRLLQYCLADTWVAEIGLVFNILGMMVFAFATITPLMFT GYGLLFLSLVVTPIIRAKLSRLVRQSEQGALFSALACVNGLAMLMASGIFNSLYPATLNL MKGFPFLLAAGLLFIPAILMGILERDNHCPEFQEFSQS*458P
Predicted Disorder Regions 1-12, 57-71, 452-459
DisProt Annotation
TM Helix Prediction 11TMHs; (86-108), (115-137), ( 146-168), (181-203), (212-234), (266-284), (303-325), (332-354), (358-376), ( 389-410), (425-443)
Bibliography 1.Sharma S, Dimasi D, Bröer S, Kumar R, Della NG. Heme carrier protein 1 (HCP1) expression and functional analysis in the retina and retinal pigment epithelium. Exp Cell Res. 2007 Apr 1;313(6):1251-9. doi: 10.1016/j.yexcr.2007.01.019. Epub 2007 Feb 6. PMID: 17335806. 2.Zhao R, Aluri S, Goldman ID. The proton-coupled folate transporter (PCFT-SLC46A1) and the syndrome of systemic and cerebral folate deficiency of infancy: Hereditary folate malabsorption. Mol Aspects Med. 2017 Feb;53:57-72. doi: 10.1016/j.mam.2016.09.002. Epub 2016 Sep 21. PMID: 27664775; PMCID: PMC5253092.