Search by BoMiProt ID - Bomi8493


Primary Information

BoMiProt ID Bomi8493
Protein Name Protocadherin-18
Organism Bos taurus
Uniprot IdA7MB46
Milk FractionWhey
Ref Sequence Id NP_001095699.1
Aminoacid Length 1134
Molecular Weight 125864
Fasta Sequence https://www.uniprot.org/uniprot/A7MB46.fasta
Gene Name PCDH18
Gene Id 539464
Protein Existence Status reviewed

Secondary Information

Protein Function is a potential calcium-dependent cell-adhesion protein.
Biochemical Properties only protocadherin member that contains a Y residue in the context of a Q/P motif .contains a motif (centered at Y842) shared with src kinases (QGQYQP) that is required for the inhibitory phenotype.
PTMs Glycosylation on Asn,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7MB46|PCD18_BOVIN Protocadherin-18 OS=Bos taurus OX=9913 GN=PCDH18 PE=2 SV=1 MYQMNAKMHFTFVFALLVVSFNLDVLGKNLKYRIYEEQRVGSVIARLSEDVADVLVKLPN PSTVRFRAMQRGNTPLLVVNEDNGEISIGAKIDREQLCQKNLN*103CSIEFDVITLPTEHLQL FHIEVEVLDINDNSPQFSRSLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSAND FFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSN DNSPAFEQQSYIIQLLENSPVGTLLLDLN*269ATDPDEGANGKIVYSFSSHVSPKIIETFKID SERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEISINLMS PGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTN ATLDREKRSEYSLTVIAEDKGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFAISENNSP GAYITTVTATDPDLGENGQVTYTILESFILGSSITTYDTIDPSNGAIYALRIFDHEEVSQ ITFVVEARDGGSPKQLVSN*559TTVVLTIIDENDNVPVVIGPALRNNTAEISIPKGAESGFHV TRIRAIDRDSGVNAELSCSIVAGNEENIFVIDPRSCDIHTNVSMESVPYTEWELSVVIQD KGNPQLHTKVLLKCVIFEYAESVTSTAMTSVSQAPLDVSMIIIISLGAICAVLLVIMVLF ATRCNREKKDTRSYNCRVAESTYQHHPKRPSRQIHKGDITLVPTVNGTLPIRSHHRSSPS SSPTLERGQMGSRQSHNSHQSLNSLVTISSNHVPENFSLELTHATPAVEVSQLLSMLHQG QYQPRPSFRGNKYSRSYRYALQDMDKFSLKDSGRGDSEAGDSDYDLGRDSPIDRLLGEGF SDLFLTDGRIPAAMRLCTEECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEFPAQPQQQ HPHQSLEDDVQPVDSGEKKKSFSTFGKDSPSEEDSGDTSTSSLLSEMSSVFQRLLPASLD TYSECTEMDRSNSLERRKGPLPAKTVGYPQGVAAWAASTHFQNPTNNSGPPLGTHSSVQP SSKWLPAMEEIPENYEEDDFDNVLNHLNDGKHELMDASELVAEINKLLQDVRQS
Predicted Disorder Regions 779-907, 933-1101
DisProt Annotation
TM Helix Prediction 1TMH; (698-720)
Significance of PTMs phosphorylation at a tyrosine motif (Y842) by src kinases is important for interaction with many factors and also imp for pcdh18 inhibitory phenotype in transfected T cells.
Bibliography 1.Vazquez-Cintron EJ, Monu NR, Burns JC, Blum R, Chen G, Lopez P, Ma J, Radoja S, Frey AB. Protocadherin-18 is a novel differentiation marker and an inhibitory signaling receptor for CD8+ effector memory T cells. PLoS One. 2012;7(5):e36101. doi: 10.1371/journal.pone.0036101. Epub 2012 May 2. PMID: 22567129; PMCID: PMC3342238.