Search by BoMiProt ID - Bomi8452


Primary Information

BoMiProt ID Bomi8452
Protein Name Protein VAC14 homolog
Organism Bos taurus
Uniprot IdA2VE70
Milk FractionExosomes
Ref Sequence Id NP_001075913.1
Aminoacid Length 783
Molecular Weight 87843
Fasta Sequence https://www.uniprot.org/uniprot/A2VE70.fasta
Gene Name VAC14
Gene Id 533202
Protein Existence Status reviewed

Secondary Information

Protein Function Scaffold protein component of the PI(3,5)P2 regulatory complex which regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Plays a role in the biogenesis of endosome carrier vesicles (ECV) / multivesicular bodies (MVB) transport intermediates from early endosomes.
Biochemical Properties Forms pentamers.Pentamerizes into a star-shaped structure and nucleates the assembly of the complex. The pentamer binds a single copy each of PIKFYVE and FIG4 and coordinates both PIKfyve kinase activity and FIG4 phosphatase activity, being required to maintain normal levels of phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 5-phosphate (PtdIns5P).The C-terminal domain (residues 523-782) mediates pentameric interactions and is necessary for the formation and maintenance of the PI(3,5)P2 regulatory complex.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VE70|VAC14_BOVIN Protein VAC14 homolog OS=Bos taurus OX=9913 GN=VAC14 PE=2 SV=1 MNPEKDFAPLT*11PNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEF ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVGFIPLL RERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL GEFLKETKKSPSSVKFAEMANILVIHCQTTDDLIQLTAMCWLREFIQLAGRVMLPYSSGI LTAVLPCLAYDDRKRNIKEVASVCNQSLMKLVTPEDDEPDEPRPVVQKQAGPSPEDCAAK QEGAASGGPDGSCDSSFSSGISVFTPASAERAPVTLHLDGIVQVLNCHLSDTAIGMMTRI AVLKWLYHLYIKTPRKMSRHTDSLFPVLLQTLSDESDEVILKDLEVLAEIASSPAGQTDD PGPLDGPDLRVSHSELQAPIPGRAGLLNTPGTKGLECS*518PSTPTMNSYFYKFMINLLKRFS SERKLLEVRGAFIIRQLCLLLHAESIFHSMADILLREEDLTFASTMVHTLNTILLTSTEL FQLRNQLKDLKTPESRNLFCCLYRSWCHKPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTV DFLTEVDKLVQLIECPIFTYLRLQLLDVKSNPYLIKALYGLLMLLPQSSAFQLLSHRLQC VPNPELLQTEDGLKAAPKSQKADS*744PSIDYAELLQHFERVQKKHLEVRHQRSGRGDHLDRR VVL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 4TMHs;(31-53),(68-90),(97-119),(148-170)