Search by BoMiProt ID - Bomi8450


Primary Information

BoMiProt ID Bomi8450
Protein Name Protein unc-119 homolog A
Organism Bos taurus
Uniprot IdQ3SYR2
Milk FractionWhey
Ref Sequence Id NP_001029817.1
Aminoacid Length 240
Molecular Weight 26987
Fasta Sequence https://www.uniprot.org/uniprot/Q3SYR2.fasta
Gene Name UNC119
Gene Id 538501
Protein Existence Status reviewed

Secondary Information

Protein Function unc-119 homolog is required for normal development of the zebrafish nervous system.
Biochemical Properties HRG4-RRG4 showed 57% homology with unc-119, a Caenorhabditis elegans neuroprotein causing defects in locomotion, feeding, and chemosensation when mutated.
PTMs Phosphorylation at Ser,N6-Acetylation at Lys, Isopeptide bond formation,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SYR2|U119A_BOVIN Protein unc-119 homolog A OS=Bos taurus OX=9913 GN=UNC119 PE=2 SV=1 MKVKKGGGGAGTGAEHAPGASGPNVEPKPELQAESES*37GS*39ES*41EPEAGPGPRPGPLQRKQPI GPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPASERLPINPRD LDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFG FCIPSSKNTCEHIYDFPALSEELINEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Predicted Disorder Regions 1-66, 113-120, 236-240
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation suppresses its interaction with KLHL18 and downregulates its KLHL18-mediated degradation.
Additional Comments Loss of function of the unc-119 gene in C. elegans results in a disorganized neural architecture and paralysis.
Bibliography 1.Manning AG, Crawford BD, Waskiewicz AJ, Pilgrim DB. unc-119 homolog required for normal development of the zebrafish nervous system. Genesis. 2004 Dec;40(4):223-30. doi: 10.1002/gene.20089. PMID: 15593328. 2.Higashide T, McLaren MJ, Inana G. Localization of HRG4, a photoreceptor protein homologous to Unc-119, in ribbon synapse. Invest Ophthalmol Vis Sci. 1998 Apr;39(5):690-8. PMID: 9538874.