Search by BoMiProt ID - Bomi8445


Primary Information

BoMiProt ID Bomi8445
Protein Name Protein tyrosine phosphatase domain-containing protein 1
Organism Bos taurus
Uniprot IdA7E379
Milk FractionWhey
Aminoacid Length 796
Molecular Weight 89386
Fasta Sequence https://www.uniprot.org/uniprot/A7E379.fasta
Gene Name PTPDC1
Gene Id 519311
Protein Existence Status reviewed

Secondary Information

Protein Function is a homologue of the mitotic phosphatase CDC14 that associates with PLK1 and has been localized to centrosomes .play roles inciliary length determination, cilia/podocyte formation and maintenance.
Biochemical Properties has calmodulin-binding IQ motif and ubiquitin-like (UBL) domain.three additional C-terminal domains: a helical solenoid segment coupled to a short Cx2Cx20Cx2C Zn2+-binding module (Z), and a novel 120-amino-acid α+β domain.
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7E379|PTPC1_BOVIN Protein tyrosine phosphatase domain-containing protein 1 OS=Bos taurus OX=9913 GN=PTPDC1 PE=2 SV=2 MQDPPRRLSAVPFLSSFFEGRRHSASDPILRLQQGRRSSAAKVLSSSSLQVMVAMSSVSC AERNPTCPERKRNSGRPTPKYTKVGERLRHVIPGHVACSMACGGKACKYENAARWSEQEQ AVKGIYSSWVTDNILAMARPSTEVLEKFCIIEQFRSHGIKSIINLQRPGEHASCGNPLEQ ESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGR TGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLIPLRNIFSCCDP KAHAVTLAQYLIRQRHLLHGYEARLLKHIPKIIHLVCKLLLDLAENRPVVTEVADIPGLS AEIEKTVSEMITRQLDKELLRHDSDASDSFTPTAVVMDFENQDVVLSSEQELDPLWKRRN VECLQPLAHLKRQLS*435YS*437DSDLKRAESLLEQGRTPWTVPAQALLCHNPRQQKHISRCYSPQ SPQLDLNKETLVRNTFSFWNHTKFGVPEGLKDDGSLIFHRTSIPKEVQRSRTFSSGISDS YNPGEPVTPNSANIPKGPNSSQQKVYHCECESHGGCGPSSVAEDGETCRRPVDCGSSPKA QFLGNETQNSKYLSEVAAHMPLQSELSVEARRILAAKALANLNEIAEKEEVKKKVEMWQK ELNSRDGAWERICGEKDPFILCSLMWSWVEQLKEPVITKEDMDMLVDRCADASEALFLLE KGQQQTILCVLHCIVSLQTIPADVEEAVLARAIKAFTKVNFDSENGPIVYNTLKKIFKRT LEEKRKMTKDNPEPGI
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography Lai CK, Gupta N, Wen X, Rangell L, Chih B, Peterson AS, Bazan JF, Li L, Scales SJ. Functional characterization of putative cilia genes by high-content analysis. Mol Biol Cell. 2011 Apr;22(7):1104-19. doi: 10.1091/mbc.E10-07-0596. Epub 2011 Feb 2. PMID: 21289087; PMCID: PMC3069013.